KEGG   Muricauda ruestringensis: Murru_1789Help
Entry
Murru_1789        CDS       T01598                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_1789
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Murru_1789
   00052 Galactose metabolism
    Murru_1789
   00500 Starch and sucrose metabolism
    Murru_1789
   00520 Amino sugar and nucleotide sugar metabolism
    Murru_1789
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Murru_1789
   00524 Butirosin and neomycin biosynthesis
    Murru_1789
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Murru_1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1957248..1958216)
Genome map
AA seq 322 aa AA seqDB search
MDLVIGIDIGGTKTKIGLVDETGKCHEKTFFRTKEFPNLDAYLDKIKSTSDELLAQFGEH
ANVIGCGIGAPNASSKNGTIENASNLVWKGSVPLVKLLKQRMDMPIRIMNDASAAALGEM
LFGGAKNMTDFIVITLGTGFGAGIVANGQLIDGYDGFAGELGHVDMTMGDGRLTGLGVKG
GLEAYVSATGLKRTVMYMQSKYMVDSRFRNIAYNDLHGEDITQAAEEGDEIALKAFDYTA
RIMAQALANFTAFTQPEAFILMGGLTNSGKWIMTPLEKYFNGFLLDVYKGKVKLLHSSME
GKTAAICGAAALIWENQKKKIA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggatttagtaatcggaatagatattggaggaaccaaaaccaaaattggattggttgat
gaaactggtaaatgccacgaaaaaactttttttagaaccaaggaattcccaaacttggat
gcttatcttgataaaataaaatctacttccgatgagcttttggcacagtttggagagcat
gccaatgtaataggttgcggtatcggcgcccctaatgcttccagtaaaaatggaaccata
gaaaatgccagtaatttagtgtggaaaggcagtgttcctttggttaaactccttaagcaa
agaatggacatgcccattcgcataatgaacgacgccagtgctgccgcattgggcgaaatg
ctctttggaggtgctaaaaacatgaccgattttattgtaattacactaggtacaggtttt
ggcgccggaatagtggccaatggtcaacttatagatggatatgacggattcgcaggcgaa
ttgggccatgtggacatgaccatgggagatggcaggttgaccggacttggcgtaaaagga
gggttggaggcttatgtatccgctaccggattaaagcgaactgttatgtatatgcagagc
aaatatatggtggatagcaggtttagaaacatcgcctataacgacctccatggggaggac
attacccaagccgcggaagaaggggacgaaattgctcttaaagcttttgactatacagcc
cgaattatggcacaggcattggccaactttacggcatttacccaacctgaagcatttatt
ttaatgggtgggctcaccaatagcggcaagtggatcatgacccctttggaaaaatacttt
aacgggttccttttagatgtgtacaagggaaaggtaaagctcctacactccagcatggag
ggaaaaacagcggctatttgcggcgccgctgcactcatctgggaaaaccaaaagaagaaa
attgcttaa

DBGET integrated database retrieval system