KEGG   Muricauda ruestringensis: Murru_1791Help
Entry
Murru_1791        CDS       T01598                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_1791
   01230 Biosynthesis of amino acids
    Murru_1791
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Murru_1791
   00030 Pentose phosphate pathway
    Murru_1791
   00051 Fructose and mannose metabolism
    Murru_1791
   00052 Galactose metabolism
    Murru_1791
  Energy metabolism
   00680 Methane metabolism
    Murru_1791
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Murru_1791
Protein phosphatases and associated proteins [BR:mrs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Murru_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959284..1960603
Genome map
AA seq 439 aa AA seqDB search
MNDKNRFSIESLGASQYTSPLQLSTVKGDHIFSFVSESDRLVFDPSIQYYNQCLNDGEAP
ICMEKAGPRQNIFFDAKNTTAAIVTCGGLCPGINNVIRGLVMALHYFYGIKKIIGIPYGY
EGLNPEKGHDFVELTPDKVKDIHQFGGTFLGSSRGEQDVSVMVDTLENNRVDMLFAIGGD
GTLKGVNAIGEEIAKRNGKISVVGIPKTIDNDIDLIDESFGFQTAFDVASPILRDAHNEA
TGAYNGISIIKLMGRDSGFIAASAALAMPVVNFVLIPEMDFSLEGEEGFLKVLEKRLQEK
KHAVIVVAEGAGQQLFKDRKMVKDASGNVQHEDIGVFLKEKIIEYFKEKRPVTIKYIDPS
YIVRCAPANSSDSVYCSGLAYHAVHGAMAGKTKFVASRINNRYVYLPVDEVTKKRKKIDL
EGEFWFSVLQSTGQPFFLG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgataaaaatagattttccatagaaagcttgggggcgtctcagtatacgtcgccg
cttcagcttagtaccgttaagggagaccacatattcagctttgtaagtgagtcggatagg
ttggtgttcgacccctccatacaatattacaatcaatgtttaaatgatggggaggcacct
atttgtatggaaaaagcaggtccaagacaaaacatcttttttgatgccaaaaacactact
gcggcaatagtcacctgtggcggtctttgcccaggaatcaacaatgtgattcgtggattg
gtaatggccctgcactatttttatgggatcaaaaaaattattgggatcccctatggttat
gaaggcctaaatcctgaaaaaggacatgatttcgtagaattgacaccggacaaggtaaag
gacatccatcaatttgggggtacttttttaggttcgtccagaggcgagcaagatgtgtct
gtaatggtggacacccttgaaaataaccgtgtggatatgttatttgccattggtggagat
ggaactttgaagggggtaaatgccattggtgaggaaattgccaaaagaaatgggaaaatc
agtgtagtgggaattccaaagaccatagacaacgatattgatcttattgacgaatccttt
ggctttcagaccgcttttgacgtagcaagtcccattttacgcgatgcccataatgaagca
acaggagcttataatggtatctccattattaaattaatgggtagggatagtggttttatt
gctgcttcggccgctttggccatgcccgtcgttaattttgtactgattcccgaaatggat
ttttcccttgagggtgaagaaggcttcttaaaagttttggaaaagcgtctacaagaaaaa
aaacatgccgttattgtggtggcagaaggtgcgggacaacaactttttaaagacagaaag
atggtaaaggatgcatcgggcaatgtacagcacgaggatattggtgttttcctaaaggaa
aaaattatagaatactttaaagaaaaaaggccagtgaccattaagtacatcgaccctagc
tatattgtgcggtgtgccccggccaactccagcgatagtgtttattgcagtggattggct
tatcatgccgtacacggagcaatggccggaaagaccaagtttgttgccagtaggataaac
aatcgttatgtgtatttgcctgttgacgaagtcactaaaaagagaaagaaaattgatttg
gaaggcgagttctggttctctgtactgcaaagcacaggtcagccgtttttcttgggataa

DBGET integrated database retrieval system