KEGG   Muricauda ruestringensis: Murru_1791Help
Entry
Murru_1791        CDS       T01598                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00010  Glycolysis / Gluconeogenesis
mrs00030  Pentose phosphate pathway
mrs00051  Fructose and mannose metabolism
mrs00052  Galactose metabolism
mrs00680  Methane metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
mrs01200  Carbon metabolism
mrs01230  Biosynthesis of amino acids
mrs03018  RNA degradation
Module
mrs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Murru_1791
   00030 Pentose phosphate pathway
    Murru_1791
   00051 Fructose and mannose metabolism
    Murru_1791
   00052 Galactose metabolism
    Murru_1791
  Energy metabolism
   00680 Methane metabolism
    Murru_1791
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Murru_1791
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Murru_1791
Protein phosphatases and associated proteins [BR:mrs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Murru_1791
Messenger RNA biogenesis [BR:mrs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Murru_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEM70831
UniProt: G2PJA4
Position
1959284..1960603
Genome map
AA seq 439 aa AA seqDB search
MNDKNRFSIESLGASQYTSPLQLSTVKGDHIFSFVSESDRLVFDPSIQYYNQCLNDGEAP
ICMEKAGPRQNIFFDAKNTTAAIVTCGGLCPGINNVIRGLVMALHYFYGIKKIIGIPYGY
EGLNPEKGHDFVELTPDKVKDIHQFGGTFLGSSRGEQDVSVMVDTLENNRVDMLFAIGGD
GTLKGVNAIGEEIAKRNGKISVVGIPKTIDNDIDLIDESFGFQTAFDVASPILRDAHNEA
TGAYNGISIIKLMGRDSGFIAASAALAMPVVNFVLIPEMDFSLEGEEGFLKVLEKRLQEK
KHAVIVVAEGAGQQLFKDRKMVKDASGNVQHEDIGVFLKEKIIEYFKEKRPVTIKYIDPS
YIVRCAPANSSDSVYCSGLAYHAVHGAMAGKTKFVASRINNRYVYLPVDEVTKKRKKIDL
EGEFWFSVLQSTGQPFFLG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgataaaaatagattttccatagaaagcttgggggcgtctcagtatacgtcgccg
cttcagcttagtaccgttaagggagaccacatattcagctttgtaagtgagtcggatagg
ttggtgttcgacccctccatacaatattacaatcaatgtttaaatgatggggaggcacct
atttgtatggaaaaagcaggtccaagacaaaacatcttttttgatgccaaaaacactact
gcggcaatagtcacctgtggcggtctttgcccaggaatcaacaatgtgattcgtggattg
gtaatggccctgcactatttttatgggatcaaaaaaattattgggatcccctatggttat
gaaggcctaaatcctgaaaaaggacatgatttcgtagaattgacaccggacaaggtaaag
gacatccatcaatttgggggtacttttttaggttcgtccagaggcgagcaagatgtgtct
gtaatggtggacacccttgaaaataaccgtgtggatatgttatttgccattggtggagat
ggaactttgaagggggtaaatgccattggtgaggaaattgccaaaagaaatgggaaaatc
agtgtagtgggaattccaaagaccatagacaacgatattgatcttattgacgaatccttt
ggctttcagaccgcttttgacgtagcaagtcccattttacgcgatgcccataatgaagca
acaggagcttataatggtatctccattattaaattaatgggtagggatagtggttttatt
gctgcttcggccgctttggccatgcccgtcgttaattttgtactgattcccgaaatggat
ttttcccttgagggtgaagaaggcttcttaaaagttttggaaaagcgtctacaagaaaaa
aaacatgccgttattgtggtggcagaaggtgcgggacaacaactttttaaagacagaaag
atggtaaaggatgcatcgggcaatgtacagcacgaggatattggtgttttcctaaaggaa
aaaattatagaatactttaaagaaaaaaggccagtgaccattaagtacatcgaccctagc
tatattgtgcggtgtgccccggccaactccagcgatagtgtttattgcagtggattggct
tatcatgccgtacacggagcaatggccggaaagaccaagtttgttgccagtaggataaac
aatcgttatgtgtatttgcctgttgacgaagtcactaaaaagagaaagaaaattgatttg
gaaggcgagttctggttctctgtactgcaaagcacaggtcagccgtttttcttgggataa

DBGET integrated database retrieval system