KEGG   Muricauda ruestringensis: Murru_1802Help
Entry
Murru_1802        CDS       T01598                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrs  Muricauda ruestringensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_1802
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_1802
  Amino acid metabolism
   00310 Lysine degradation
    Murru_1802
Enzymes [BR:mrs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Murru_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1971373..1972593
Genome map
AA seq 406 aa AA seqDB search
MVLEMKVPSPGESITEVEIADWLVEDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EVGDAVAVGEVVCLIDTSAEKPEGSSGGSDKKEEPKKEEPKKEAPKKEESKKETYASGTP
SPAAKKILDEKGIEPSSVSGSGRDGRITKDDAVKAKPSMGTPTGGNRGESRSKLSMLRRK
VAERLVSAKNETAMLTTFNEVDMSAIFELRKEYKEQFKEKHGVSLGFMSFFTKAVIRALE
MYPSVNSMIDGKEMITYDFCDISIAVSGPKGLMVPVIRNAENLTFRGIESEVKRLAIRAR
EGEITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSGILGMHNIVERAIVRDGAIAIAPV
MYVALSYDHRIIDGKESVGFLVAVKEALESPEELLMDDNVKKALEL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggttttagaaatgaaagttccctcaccaggggaatccattacagaagtagaaattgcc
gattggttggttgaggatggagattatgtggagaaagaccaagccatagccgaggtggac
tcggacaaggcaacattggagcttcctgcggaggcgagtggtattattacccttaaggcc
gaagtgggggacgccgtagccgttggcgaggtggtttgcctcatcgatacgagtgcggaa
aagcctgaaggttcatctggtggttccgataaaaaagaagaacccaaaaaggaagaaccc
aaaaaagaagcgcctaagaaagaagaatccaaaaaggaaacctatgcttccgggactcca
tctcctgcagcaaagaaaatattggatgaaaaaggaatcgaaccctcatctgtttctgga
agcggaagagatgggcgtatcaccaaagatgatgctgtaaaagctaagccatccatggga
accccaactggtggtaaccgtggtgaaagccgttccaaactgtccatgttgcgcagaaaa
gtggccgagcgattggtttcggcaaagaacgagaccgcgatgctgaccaccttcaacgaa
gtcgatatgtcggcaatctttgagttacgtaaagaatacaaagaacagttcaaagaaaag
catggggtaagtcttgggtttatgtcattcttcaccaaggcggtgatcagagcattggaa
atgtacccctctgtgaactccatgattgatggcaaggaaatgatcacttatgatttctgc
gacatcagtatagcggtttcagggcctaaaggattgatggttcccgtaatccgtaatgca
gagaaccttacgtttagggggattgaatccgaagttaaacgtttggccattcgtgccaga
gaaggtgagattaccgtggatgaaatgaccggtggtacctttaccataaccaacgggggt
gtatttggatctatgttgtccactccgatcatcaacccaccacaaagtgggattttaggt
atgcacaacattgtggaacgtgccattgttagggatggcgccattgccatcgcacctgta
atgtacgttgcactttcttatgatcatagaattattgatggtaaagaatccgtaggattt
ttggtagctgtaaaggaagccttggaaagtccagaagaattgttgatggacgataatgtg
aaaaaagcgttggaattataa

DBGET integrated database retrieval system