KEGG   Muricauda ruestringensis: Murru_1867Help
Entry
Murru_1867        CDS       T01598                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mrs  Muricauda ruestringensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Murru_1867
Enzymes [BR:mrs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Murru_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2049918..2050499
Genome map
AA seq 193 aa AA seqDB search
MITHLRGKLVEKNPTYAIVECNGVGYFLNISLHTFSLLQDEENIFIYTDLLVKEDSHTLF
GFAERAEREVFRLLISVSGVGASTARTMLSSLSPSDVRDAIANGDVPTIQSVKGIGAKTA
QRVILDLKDKILKVYDIGEVSQQSNNTNKEEALSALEVLGFTRKQSEKVVDKVVSQDTSL
SVENIIKLALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattacccatttaagaggaaaactagtagagaagaatccaacctatgccattgtggag
tgtaatggagtagggtattttttaaatatttcgttgcacactttttccctgcttcaggat
gaggaaaacatatttatttataccgatttattggttaaggaagattctcataccttgttc
ggttttgccgaacgggcggagcgtgaagtgttccgtttattgatatcggtttcaggagtt
ggtgccagcacggcgcgcaccatgttatcctctttgtccccatccgatgtaagggatgcc
atagccaatggagatgtgcccaccatccagtccgtaaaagggattggagccaaaacggca
caacgtgtaatcttggatttgaaggataagattttaaaagtctacgacataggcgaagtt
tcacaacaatcaaacaatacaaataaagaagaagcgttatctgcattagaggttcttggt
tttaccagaaagcaatccgaaaaggtggtggacaaggtagtttcccaagacacttcgcta
agcgtagagaacattattaaactggcgctcaaaaatttgtaa

DBGET integrated database retrieval system