KEGG   Muricauda ruestringensis: Murru_2102Help
Entry
Murru_2102        CDS       T01598                                 

Definition
aspartate transaminase
Orthology
K00812  
aspartate aminotransferase [EC:2.6.1.1]
Organism
mrs  Muricauda ruestringensis
Pathway
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Murru_2102
   01230 Biosynthesis of amino acids
    Murru_2102
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Murru_2102
   00270 Cysteine and methionine metabolism
    Murru_2102
   00330 Arginine and proline metabolism
    Murru_2102
   00350 Tyrosine metabolism
    Murru_2102
   00360 Phenylalanine metabolism
    Murru_2102
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2102
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Murru_2102
Enzymes [BR:mrs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     Murru_2102
Amino acid related enzymes [BR:mrs01007]
 Aminotransferase (transaminase)
  Class I
   Murru_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2310252..2311442)
Genome map
AA seq 396 aa AA seqDB search
MPSISKKGTQMPASPIRKLVPYAEAAKKRGTHVIHLNIGQPDIKTPKVALDAVRNHTIEV
LEYSMTQGSEEYRQKIAAYYAKRDIFVDAEDIIVTTGGSEALSFTMGSIMDNDDEIIIPE
PFYANYNGFATAAGVKVQPIASSIENNFALPPISKFEELITPKTKAILICNPGNPTGYLY
SKEEIEQLADLVKKHNLFLVADEVYREFTYDGREHYSILQVDGLEQHAIVVDSVSKRYSM
CGARIGCLISKNTEVIATAMKFAQARLSPPTFAQIASEAALETPQEYFDDVIEEYVSRRN
LLITELNKLEGVKVATPQGAFYCVAELPIEDADHFAQWLLESYELNGNTVMVAPAAGFYA
TPGLGKNQIRIAYVLEKEQLVKAVQILGKALTEYNA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtatctcgaagaaagggacacaaatgcccgcatcgcccatccgtaaattggta
ccctacgcagaggctgcaaaaaaacggggaacccatgtaatccacctcaacattggacaa
cccgatatcaaaacaccaaaggtggctttggatgctgtacgaaaccatactattgaggta
cttgaatacagcatgacccagggttccgaagaataccgtcaaaaaattgctgcttattat
gccaaacgggacatttttgttgatgccgaagatattattgtaaccacaggagggtccgaa
gcattatcttttaccatggggtccattatggacaacgatgatgaaatcattatacctgag
ccattttatgccaactataacggttttgccactgctgcgggggttaaagtacaacctatt
gcttcatccattgaaaataattttgccctccctcccatttccaagtttgaagagctcatt
actccaaaaacaaaggctatccttatttgtaaccctgggaatcccacgggatacctttat
agcaaagaagaaatagaacaattggccgatttggtcaaaaaacacaacctttttttggtg
gcagatgaagtgtaccgcgaattcacctacgatggaagggagcattactctattcttcag
gttgatgggctggaacaacacgccattgttgtagactccgtttccaagcgttacagtatg
tgcggggcacggatcggttgtttgatttccaaaaacaccgaggtaatagcaactgcaatg
aaatttgcccaagcaagactttctccaccaacttttgcccaaattgcaagtgaagcggca
ttggaaaccccacaagaatattttgatgatgtaatcgaggaatatgtttctcgaagaaac
ctgctcatcacagagctcaacaaactggaaggcgtaaaagtagctaccccacaaggcgcc
ttttactgcgtggcagaactacctatagaagatgccgatcactttgcacaatggttgctc
gaaagttatgaactcaatggcaataccgtgatggtggctccagcagcaggcttttatgcc
acgccaggtttgggaaaaaatcagataagaattgcctatgtgctcgaaaaagagcaactt
gtaaaggccgtccaaatattgggcaaggccttaacagagtacaacgcctag

DBGET integrated database retrieval system