KEGG   Muricauda ruestringensis: Murru_2134Help
Entry
Murru_2134        CDS       T01598                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Murru_2134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2134
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2134
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Murru_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2342723..2343484)
Genome map
AA seq 253 aa AA seqDB search
MNRIKQKLQEDKKILSIYFSAGYPNLNDTVKIIEDLEKSGVDLIEIGLPFSDPLADGPTI
QESSTAALKNGMNTALLFEQLKDIRKTVSIPLILMGYFNPVLQYGVEEFCTKCEEIGIDG
LILPDLPLDVYNEEYEAIFKKHGLINVFLITPQTSDERIKAIDEASEGFIYMVSSASTTG
AKQGFGTEQSAYFERIANMQLKNPQIVGFGISNAETFVQATEKAKGAIIGSAFIKHLTEN
GVDGIGDFVRQIG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcaaacaaaaactacaagaggacaaaaaaatcctctccatatacttttcg
gctggttatcccaatttgaacgacaccgttaaaatcatcgaagatttggaaaaaagtggg
gtcgacctcatcgaaatagggcttccgttcagtgaccctttggccgatggcccaaccatt
caggaaagctccaccgctgcgttaaaaaatggaatgaacacggctttgctctttgagcaa
ttaaaagacattcgcaaaacggtttccattcctttgatcctaatgggttattttaatcca
gtacttcaatatggtgtggaggagttttgcactaaatgtgaagaaattggtattgatgga
ctcattctaccagaccttcctttagatgtttacaacgaggaatacgaagccattttcaaa
aaacacggactgatcaacgtctttttaattaccccacaaactagcgatgaacgtatcaaa
gctattgatgaagcctccgagggttttatttatatggtaagttccgcgagtactacggga
gccaaacaaggttttggaacggaacaatcagcctattttgagcgtattgccaacatgcag
ttgaaaaaccctcaaattgttgggtttggcattagtaatgcggaaacttttgttcaagca
acggaaaaagccaaaggagctatcattggttcggccttcatcaaacatttaacagaaaat
ggagtggacggtattggtgactttgtgaggcaaattggttaa

DBGET integrated database retrieval system