KEGG   Muricauda ruestringensis: Murru_2134Help
Entry
Murru_2134        CDS       T01598                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00260  Glycine, serine and threonine metabolism
mrs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01130  Biosynthesis of antibiotics
mrs01230  Biosynthesis of amino acids
Module
mrs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2134
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2134
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Murru_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth DMRL_synthase HMGL-like RRM_7
Motif
Other DBs
NCBI-ProteinID: AEM71173
UniProt: G2PM76
Position
complement(2342723..2343484)
Genome map
AA seq 253 aa AA seqDB search
MNRIKQKLQEDKKILSIYFSAGYPNLNDTVKIIEDLEKSGVDLIEIGLPFSDPLADGPTI
QESSTAALKNGMNTALLFEQLKDIRKTVSIPLILMGYFNPVLQYGVEEFCTKCEEIGIDG
LILPDLPLDVYNEEYEAIFKKHGLINVFLITPQTSDERIKAIDEASEGFIYMVSSASTTG
AKQGFGTEQSAYFERIANMQLKNPQIVGFGISNAETFVQATEKAKGAIIGSAFIKHLTEN
GVDGIGDFVRQIG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcaaacaaaaactacaagaggacaaaaaaatcctctccatatacttttcg
gctggttatcccaatttgaacgacaccgttaaaatcatcgaagatttggaaaaaagtggg
gtcgacctcatcgaaatagggcttccgttcagtgaccctttggccgatggcccaaccatt
caggaaagctccaccgctgcgttaaaaaatggaatgaacacggctttgctctttgagcaa
ttaaaagacattcgcaaaacggtttccattcctttgatcctaatgggttattttaatcca
gtacttcaatatggtgtggaggagttttgcactaaatgtgaagaaattggtattgatgga
ctcattctaccagaccttcctttagatgtttacaacgaggaatacgaagccattttcaaa
aaacacggactgatcaacgtctttttaattaccccacaaactagcgatgaacgtatcaaa
gctattgatgaagcctccgagggttttatttatatggtaagttccgcgagtactacggga
gccaaacaaggttttggaacggaacaatcagcctattttgagcgtattgccaacatgcag
ttgaaaaaccctcaaattgttgggtttggcattagtaatgcggaaacttttgttcaagca
acggaaaaagccaaaggagctatcattggttcggccttcatcaaacatttaacagaaaat
ggagtggacggtattggtgactttgtgaggcaaattggttaa

DBGET integrated database retrieval system