KEGG   Muricauda ruestringensis: Murru_2134Help
Entry
Murru_2134        CDS       T01598                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Murru_2134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2134
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2134
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Murru_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2342723..2343484)
Genome map
AA seq 253 aa AA seqDB search
MNRIKQKLQEDKKILSIYFSAGYPNLNDTVKIIEDLEKSGVDLIEIGLPFSDPLADGPTI
QESSTAALKNGMNTALLFEQLKDIRKTVSIPLILMGYFNPVLQYGVEEFCTKCEEIGIDG
LILPDLPLDVYNEEYEAIFKKHGLINVFLITPQTSDERIKAIDEASEGFIYMVSSASTTG
AKQGFGTEQSAYFERIANMQLKNPQIVGFGISNAETFVQATEKAKGAIIGSAFIKHLTEN
GVDGIGDFVRQIG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatcaaacaaaaactacaagaggacaaaaaaatcctctccatatacttttcg
gctggttatcccaatttgaacgacaccgttaaaatcatcgaagatttggaaaaaagtggg
gtcgacctcatcgaaatagggcttccgttcagtgaccctttggccgatggcccaaccatt
caggaaagctccaccgctgcgttaaaaaatggaatgaacacggctttgctctttgagcaa
ttaaaagacattcgcaaaacggtttccattcctttgatcctaatgggttattttaatcca
gtacttcaatatggtgtggaggagttttgcactaaatgtgaagaaattggtattgatgga
ctcattctaccagaccttcctttagatgtttacaacgaggaatacgaagccattttcaaa
aaacacggactgatcaacgtctttttaattaccccacaaactagcgatgaacgtatcaaa
gctattgatgaagcctccgagggttttatttatatggtaagttccgcgagtactacggga
gccaaacaaggttttggaacggaacaatcagcctattttgagcgtattgccaacatgcag
ttgaaaaaccctcaaattgttgggtttggcattagtaatgcggaaacttttgttcaagca
acggaaaaagccaaaggagctatcattggttcggccttcatcaaacatttaacagaaaat
ggagtggacggtattggtgactttgtgaggcaaattggttaa

DBGET integrated database retrieval system