KEGG   Muricauda ruestringensis: Murru_2135Help
Entry
Murru_2135        CDS       T01598                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mrs  Muricauda ruestringensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Murru_2135
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2135
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2135
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Murru_2135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2343692..2344876)
Genome map
AA seq 394 aa AA seqDB search
MKSYHADERGYYGEFGGAFIPEMLYPNCEELRQNYLSIMEEPSFKEEFHQLLKDYVGRPT
PLYFANRLSEKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLGKNRIIAETGAGQHGV
ATATVCALMGIECIVYMGEIDIARQAPNVARMKMLGAEVRPATSGSKTLKDATNEAIRDW
INNPVDTHYIIGSVVGPHPYPDMVARFQSVISEEIKSQLQEKEGREKPDYVVACVGGGSN
AAGAFYHYLDTPDVGIIAVEAAGKGIHSGESAATSALGKVGIIHGSKTLLMQTQDGQITE
PYSISAGLDYPGVGPMHAHLYTSGRGEFISITDDDAMKAGLELCKLEGIIPAIESSHALA
IFEDRKFNPDDVVVVNLSGRGDKDLQNYIDYFKL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaagagctatcatgcggatgaacgggggtattatggtgagttcgggggagcatttatc
ccggaaatgctgtatcccaattgcgaagagcttcggcagaactacctcagtattatggaa
gaaccttcgttcaaagaagaattccatcaattgctgaaagattatgtgggcaggcccaca
ccgctttatttcgccaaccgtctatccgaaaaatacaacacaaaaatctatctgaaacgc
gaagatttgtgccataccggagcccataaagtcaacaacaccattgggcaaatactgatg
gccaaaaagttgggcaaaaaccgaatcattgcagaaactggtgctggacaacatggtgtg
gccactgctacggtctgtgctcttatggggattgaatgcatagtttatatgggtgaaata
gatattgcccgccaagcacctaacgttgcccgtatgaaaatgttgggcgcagaggtcagg
cccgcaacatcgggcagtaaaaccttaaaagatgccaccaacgaagctatcagggattgg
attaacaatcccgtggatacgcattacattattggttccgtggtcggtccccacccatac
ccggatatggtagcacgatttcaatctgtaatttccgaagaaatcaaaagtcaacttcaa
gaaaaagaaggacgcgaaaaacctgattatgtggtagcctgtgtaggtggcggaagtaat
gctgcgggagcgttctaccattatcttgatactccggacgtaggcatcattgccgtggaa
gccgcaggaaaaggcattcattcgggtgaaagtgctgccacctccgccttaggcaaagta
ggcattatccatggtagcaaaaccttgttgatgcagacccaagatggacagattaccgaa
ccctactccatttcggcaggattggattacccgggtgtagggcccatgcacgcacatttg
tacacgtctggcaggggtgagtttatttccattaccgatgatgacgctatgaaggctggt
ttggagctttgcaaactggaaggtattatcccagctattgaatcttcccatgccctcgcc
atttttgaggacaggaaattcaatccagatgatgtggtggtggtaaacctatccggacgt
ggcgacaaagatttacagaactatattgattattttaaattataa

DBGET integrated database retrieval system