KEGG   Muricauda ruestringensis: Murru_2137Help
Entry
Murru_2137        CDS       T01598                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01130  Biosynthesis of antibiotics
mrs01230  Biosynthesis of amino acids
Module
mrs_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Murru_2137
Enzymes [BR:mrs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Murru_2137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEM71176
UniProt: G2PM79
Position
complement(2345722..2346507)
Genome map
AA seq 261 aa AA seqDB search
MNILDKIVADKRQEVDLKKSLITLPQLEASVMMERTSVSLAEVLRKSNSGIIAEHKRRSP
SKSVINQSLSIQDVAKGYTNAGACGISVLTDGKYFGGSLDDLVLARASTNIPILRKEFII
DEYQIIEAKAYGADVILLIAAILSKEEIKTLSELAKGLGLDVLLEVHNEEELEKSLMPSL
DMLGVNNRNLKTFEVDLDISKSLSVKIPDDFVKVSESGISSVKAIRDLKAFGYKGFLIGE
NFMKTDNPGENAKKFIDELKK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacatactagacaaaatagtagccgataaacgccaagaagtcgatttaaaaaaatct
ctgataaccctgccccaattggaggcctcggtaatgatggaacgcacctccgtctccttg
gcagaagtattgcgcaagagcaactcggggattattgcggagcacaaacgccgttcccca
tccaaatctgtaatcaatcaaagtttaagtatacaggatgtggccaagggttataccaat
gcaggtgcctgcggaatatccgtactcactgatggcaagtactttggcggctcgttggat
gatctggtgctcgcaagggcatccaccaacattcccattttgcgaaaagagttcatcata
gatgaatatcaaattatagaagccaaagcttatggtgcagacgtaattttattgattgcc
gctattctgtccaaagaagagataaaaaccttgtccgaactggccaaaggtttgggactg
gatgtattgcttgaggtacataatgaagaagaactcgaaaaatccctaatgccaagtttg
gatatgttgggagtaaacaaccgcaaccttaaaacttttgaagttgatttggacatcagc
aaatcattatcggttaaaatacctgatgattttgtgaaagtttccgagagcggcattagt
tcggttaaggccattcgggatttaaaagcgtttggctataaaggttttttaatcggggaa
aattttatgaagacggacaatccgggtgaaaatgcaaaaaaatttattgatgaattaaaa
aaataa

DBGET integrated database retrieval system