KEGG   Muricauda ruestringensis: Murru_2199Help
Entry
Murru_2199        CDS       T01598                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mrs  Muricauda ruestringensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Murru_2199
DNA repair and recombination proteins [BR:mrs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Murru_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2413729..2414349
Genome map
AA seq 206 aa AA seqDB search
MEFSSKLLENAVYEMSQLPGIGKRTALRLVLHLLKQPEERTELLAHALLKLKSEVNFCKN
CHNISDTELCEICANPKRDETIVCVVEDIRDVMAIENTSQYNGLYHVLGGKISPMEGVGP
QDLNIASLVNKVKNGVVKELILALSSTMEGDTTNFYIYKQLDGLEVTTSTIARGISVGDE
LEYADEVTLGRSIINRVPFESSIKAN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcatcgaagctattggaaaatgcagtttacgaaatgtcgcaattgccggga
atcggtaagcgaacggcattacggctggtattgcacctgctaaaacagcccgaagaaagg
accgaactgttggcacatgccctgctaaaattgaagagcgaggtcaatttttgtaaaaac
tgccacaatatttccgataccgaactgtgcgaaatttgcgccaatcccaaacgggatgaa
accatcgtttgtgtggtggaggacattagggatgtaatggccattgagaatacatcgcag
tacaatggattgtaccatgtactgggaggtaaaatatcccccatggaaggcgtgggtccc
caagacctaaatatagcatcgttggtcaataaggtgaagaatggagttgtaaaagaattg
attttggccctgagttccaccatggaaggcgataccactaatttttatatttataaacaa
ttggacggactggaggttacaacttccacgattgccagaggtatctcggtcggggatgaa
ttggaatatgcggatgaggtaactttgggaagaagtatcatcaatagagtgccttttgaa
agctctataaaagcgaattaa

DBGET integrated database retrieval system