KEGG   Muricauda ruestringensis: Murru_2200Help
Entry
Murru_2200        CDS       T01598                                 

Definition
dihydrolipoyllysine-residue succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrs  Muricauda ruestringensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_2200
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_2200
  Amino acid metabolism
   00310 Lysine degradation
    Murru_2200
Enzymes [BR:mrs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Murru_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414429..2415790
Genome map
AA seq 453 aa AA seqDB search
MSKFELKLPQMGESVAEATLTNWLKEVGDTIEMDEAIFEIATDKVDSEVPSEVDGVLLEK
RFNVDDVIKVGEVVAVIQIEGEVDHVADDSSDEEMVEEPAEVPARELEAQMAGVKESVSA
PAPDFSSSERFYSPLVKNIAKEENVSMDELEAIVGTGKKGRVTKNDIMAYLENRSNGNET
KVEAAPQQEVKTEKASTPIAPKETVADKPKESKVQVGAGDEVIPLTRMGKLIAHHMIESV
STSAHVQSFVEVDVTNVVNWRNKVKNAFQQREGEKLTFTPIFMEAVAMALKKYPLMNISL
DGDKVIKKKNINLGMAAALPDGNLIVPVIKNADQLNLVGMAKTVNDLASRARNNQLKPDE
VKDGTYTVTNVGSFGSVFGTPIINQPQVGILALGAIRKMPSVIETDQGEYIGIRSKMYLS
HSYDHRVVNGALGGMFVKAVADYLEAWDINREI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatttgaattgaaattaccgcaaatgggagaaagtgtcgcagaagctaccttg
accaactggttgaaggaagtgggcgataccattgagatggacgaggccatctttgaaatt
gccaccgataaagtggattccgaagttcccagtgaagtagatggagtattgttggaaaag
cggttcaatgtagatgatgtcataaaagttggtgaagtggtcgccgtaatccaaatagaa
ggtgaagttgatcatgtagcggatgacagctccgatgaagaaatggtagaggaaccagca
gaagtaccagcgagggaattggaagcccaaatggcgggagtgaaagagtctgtttccgcc
ccagcgcccgatttttcaagttcggaacgattctattcacctttggtgaagaatattgcc
aaggaagaaaatgtttccatggacgaattggaagccattgtaggaacgggaaaaaaaggc
agggtcacaaaaaatgatatcatggcctatttggaaaaccgttccaatggaaacgaaacc
aaagtagaagcagcaccacagcaagaggtcaagactgaaaaagcatccacacccatagca
ccaaaagaaacggttgcggataaaccaaaagaatccaaagttcaagtgggagcaggggat
gaggtgattccgctgactcgaatgggcaaattgatcgcccatcacatgatcgagagtgta
tctacatcggcacatgtacaaagttttgtggaagtggatgtgaccaatgtggtgaactgg
agaaacaaggtgaagaatgctttccaacagcgagaaggtgaaaaattgacctttacaccc
atatttatggaagctgtggccatggccttgaaaaagtatccgttgatgaacatatcgttg
gatggggacaaggtcattaaaaagaaaaacatcaacttaggtatggcagcagccctgccc
gatggtaatttaatagttcccgtgattaaaaatgccgatcaattgaacttggtaggcatg
gctaaaacagtgaacgaccttgccagtagagcgagaaataatcagttaaagcccgacgag
gtaaaagatggtacatacacggtaaccaatgtcggttccttcggaagcgtattcggaacg
ccgatcatcaatcaaccacaagtgggaatccttgcgttgggggccattagaaaaatgcca
tcggtcatagaaaccgatcaaggagaatatatcggtatccgaagtaaaatgtacctatcg
cacagttacgatcaccgcgtggtaaacggcgcattgggcggaatgttcgttaaagccgtg
gccgattatttggaagcttgggacataaacagggaaatataa

DBGET integrated database retrieval system