KEGG   Muricauda ruestringensis: Murru_2220Help
Entry
Murru_2220        CDS       T01598                                 

Definition
aconitate hydratase
Orthology
K01681  
aconitate hydratase [EC:4.2.1.3]
Organism
mrs  Muricauda ruestringensis
Pathway
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Murru_2220
   01210 2-Oxocarboxylic acid metabolism
    Murru_2220
   01230 Biosynthesis of amino acids
    Murru_2220
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_2220
   00630 Glyoxylate and dicarboxylate metabolism
    Murru_2220
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Murru_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2431622..2433889
Genome map
AA seq 755 aa AA seqDB search
MAFDIDMIKGVYASIGERVEKARELVGKPLTLSEKILYSHLWDGKPEKAFVRGKDYVDFA
PDRIACQDATAQMALLQFMQAGKDKVAVPTTVHCDHLIQAKDGAASDLKHANETSKEVFD
FLGSVSNKYGIGFWKPGAGIIHQVVLENYAFPGGMMIGTDSHTVNAGGLGMVAIGVGGAD
AVDVMAGMAWELKFPKLIGVKLTGKLSGWTAPKDVILKVAEILTVKGGTGAIVEYFGPGA
TSMSCTGKGTICNMGAEIGATTSTFGYDESMERYLRATDREDVADEANKVKEHLTADPEV
YANPEQYFDQVIEINLTELKPLLNGPFTPDLATEVGTMREKAEKNDWPLAVEWGLIGSCT
NSSYEDLSRASSIAQQALDKKLKTKAEFGINPGSEQVRYTTERDGILEIFEKLDAKIFTN
ACGPCIGQWARYKDPKNAPKNSIVHSFNRNFAKRADGNPNTHAFVASPEMTAAIAIAGRL
DFNPLTDKLINEDGEEVMLDEPTGWELPPKGFEVKENGYEDPLEDGSGVEVKVATDSERL
QLLEPFVPIKASDLQGMKLLIKAFGKCTTDHISMAGPWLRFRGHLDNIANNTLIGAVNAF
NQKTNFVKNQITGEYGGVPDTQREYKKKGIKTVVVGDHNYGEGSSREHAAMQPRHLGVAV
VLVKSFARIHETNLKKQGMLALTFANEDDYDLIQEDDTFNIVDAAEFAPDKPLTIEVVHA
DGSKDTIVTNHTYNDAQIKWFNEGSALNLIKKQNA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatatagacatgattaagggtgtttacgcttccataggggaacgtgtagaa
aaagcccgtgaattggtgggcaagccccttacactttccgaaaaaatcttatactcccac
ctttgggacggtaaacccgaaaaagcatttgtaagaggcaaggattacgttgactttgca
cccgatagaatcgcttgtcaagatgcaacggcacaaatggccttgcttcaatttatgcag
gcgggcaaggataaagtagcggtgcctacaacggttcactgtgatcacttgatccaagcc
aaggatggtgcagcatcagatttgaagcatgccaacgaaaccagtaaagaggtttttgac
ttcttggggtctgtatcgaacaaatatggaattggattttggaaaccaggtgcaggtatt
attcaccaagtagtcttggaaaattatgcatttcctggaggtatgatgatcggaaccgat
tcccacaccgtaaacgccggtggattgggaatggtggccattggtgttggtggggccgat
gccgtggatgtaatggccggaatggcctgggagctcaaattccccaagttgatcggtgta
aaattgaccggtaagctatccggttggacagcccctaaagatgttattctaaaagtggcc
gaaatccttaccgtaaaaggaggaacaggtgccattgtggaatattttggcccaggagca
acttccatgtcctgtaccggtaaaggaaccatctgtaacatgggtgcggaaattggagct
accacttccacatttggttacgacgaatccatggagcgctatttaagggcaaccgatagg
gaagatgttgcggatgaggcaaacaaggtaaaagaacatttgacagccgacccagaggtg
tacgccaaccctgagcaatattttgatcaagtaatcgaaatcaacttgacggaattgaaa
cctctattgaacggtccctttacccctgacttggctacggaagtagggacaatgagggaa
aaagccgagaaaaacgattggcctttggctgtggagtggggattgataggttcctgtacc
aactcgtcctatgaagatttgtcgagagcatcgtccatcgcacaacaagccttggacaaa
aaattgaagacaaaagctgaatttggtatcaacccaggttcggaacaagtaagatatact
acggagcgtgatggtatcctagagatattcgaaaaactggatgccaagatttttacgaac
gcctgcggaccatgtataggtcaatgggcacgttacaaagatccgaagaacgctccaaag
aacagtattgtacattcctttaaccgaaacttcgcaaagcgtgccgatgggaaccccaat
acacacgcattcgtggcttcgccggaaatgaccgctgcaatcgcaattgcgggtcgtttg
gactttaaccccttgacagataagttgatcaacgaagatggcgaggaagttatgttggac
gagccaacaggatgggaactgccaccgaaaggatttgaagttaaagagaacggttacgaa
gacccacttgaagatggtagtggagtagaggtgaaggtagctacggactctgagcgttta
caattgttggagccatttgtgccaatcaaagcaagtgaccttcagggtatgaaattgttg
atcaaggcctttggaaaatgtactactgaccatatttccatggcaggaccatggttgcgt
ttcagggggcatttggacaatattgccaataatactttgattggagcagtaaatgccttc
aaccaaaaaaccaacttcgttaaaaaccaaatcacaggtgagtacggaggtgttccggat
acgcagcgcgaatacaagaaaaaaggtattaagacggttgttgtgggagaccataactac
ggtgaaggttcatcaagggagcatgcggccatgcaaccaagacacttgggtgttgccgtt
gtattggtaaaatccttcgcaaggatccacgagaccaaccttaagaaacaagggatgttg
gcgttgacctttgccaatgaggacgattacgatttgattcaggaagacgatacgttcaat
attgttgatgccgctgagtttgccccggataaacctttgaccatcgaagtagtgcatgcc
gatggaagtaaggataccatcgtaacaaaccatacatacaacgatgcgcagatcaagtgg
ttcaacgaaggttcggccttgaacttgatcaagaaacagaatgcttaa

DBGET integrated database retrieval system