KEGG   Muricauda ruestringensis: Murru_2220Help
Entry
Murru_2220        CDS       T01598                                 

Definition
(GenBank) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00020  Citrate cycle (TCA cycle)
mrs00630  Glyoxylate and dicarboxylate metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
mrs01200  Carbon metabolism
mrs01210  2-Oxocarboxylic acid metabolism
mrs01230  Biosynthesis of amino acids
Module
mrs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Murru_2220
   00630 Glyoxylate and dicarboxylate metabolism
    Murru_2220
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Murru_2220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEM71259
UniProt: G2PMU7
Position
2431622..2433889
Genome map
AA seq 755 aa AA seqDB search
MAFDIDMIKGVYASIGERVEKARELVGKPLTLSEKILYSHLWDGKPEKAFVRGKDYVDFA
PDRIACQDATAQMALLQFMQAGKDKVAVPTTVHCDHLIQAKDGAASDLKHANETSKEVFD
FLGSVSNKYGIGFWKPGAGIIHQVVLENYAFPGGMMIGTDSHTVNAGGLGMVAIGVGGAD
AVDVMAGMAWELKFPKLIGVKLTGKLSGWTAPKDVILKVAEILTVKGGTGAIVEYFGPGA
TSMSCTGKGTICNMGAEIGATTSTFGYDESMERYLRATDREDVADEANKVKEHLTADPEV
YANPEQYFDQVIEINLTELKPLLNGPFTPDLATEVGTMREKAEKNDWPLAVEWGLIGSCT
NSSYEDLSRASSIAQQALDKKLKTKAEFGINPGSEQVRYTTERDGILEIFEKLDAKIFTN
ACGPCIGQWARYKDPKNAPKNSIVHSFNRNFAKRADGNPNTHAFVASPEMTAAIAIAGRL
DFNPLTDKLINEDGEEVMLDEPTGWELPPKGFEVKENGYEDPLEDGSGVEVKVATDSERL
QLLEPFVPIKASDLQGMKLLIKAFGKCTTDHISMAGPWLRFRGHLDNIANNTLIGAVNAF
NQKTNFVKNQITGEYGGVPDTQREYKKKGIKTVVVGDHNYGEGSSREHAAMQPRHLGVAV
VLVKSFARIHETNLKKQGMLALTFANEDDYDLIQEDDTFNIVDAAEFAPDKPLTIEVVHA
DGSKDTIVTNHTYNDAQIKWFNEGSALNLIKKQNA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatatagacatgattaagggtgtttacgcttccataggggaacgtgtagaa
aaagcccgtgaattggtgggcaagccccttacactttccgaaaaaatcttatactcccac
ctttgggacggtaaacccgaaaaagcatttgtaagaggcaaggattacgttgactttgca
cccgatagaatcgcttgtcaagatgcaacggcacaaatggccttgcttcaatttatgcag
gcgggcaaggataaagtagcggtgcctacaacggttcactgtgatcacttgatccaagcc
aaggatggtgcagcatcagatttgaagcatgccaacgaaaccagtaaagaggtttttgac
ttcttggggtctgtatcgaacaaatatggaattggattttggaaaccaggtgcaggtatt
attcaccaagtagtcttggaaaattatgcatttcctggaggtatgatgatcggaaccgat
tcccacaccgtaaacgccggtggattgggaatggtggccattggtgttggtggggccgat
gccgtggatgtaatggccggaatggcctgggagctcaaattccccaagttgatcggtgta
aaattgaccggtaagctatccggttggacagcccctaaagatgttattctaaaagtggcc
gaaatccttaccgtaaaaggaggaacaggtgccattgtggaatattttggcccaggagca
acttccatgtcctgtaccggtaaaggaaccatctgtaacatgggtgcggaaattggagct
accacttccacatttggttacgacgaatccatggagcgctatttaagggcaaccgatagg
gaagatgttgcggatgaggcaaacaaggtaaaagaacatttgacagccgacccagaggtg
tacgccaaccctgagcaatattttgatcaagtaatcgaaatcaacttgacggaattgaaa
cctctattgaacggtccctttacccctgacttggctacggaagtagggacaatgagggaa
aaagccgagaaaaacgattggcctttggctgtggagtggggattgataggttcctgtacc
aactcgtcctatgaagatttgtcgagagcatcgtccatcgcacaacaagccttggacaaa
aaattgaagacaaaagctgaatttggtatcaacccaggttcggaacaagtaagatatact
acggagcgtgatggtatcctagagatattcgaaaaactggatgccaagatttttacgaac
gcctgcggaccatgtataggtcaatgggcacgttacaaagatccgaagaacgctccaaag
aacagtattgtacattcctttaaccgaaacttcgcaaagcgtgccgatgggaaccccaat
acacacgcattcgtggcttcgccggaaatgaccgctgcaatcgcaattgcgggtcgtttg
gactttaaccccttgacagataagttgatcaacgaagatggcgaggaagttatgttggac
gagccaacaggatgggaactgccaccgaaaggatttgaagttaaagagaacggttacgaa
gacccacttgaagatggtagtggagtagaggtgaaggtagctacggactctgagcgttta
caattgttggagccatttgtgccaatcaaagcaagtgaccttcagggtatgaaattgttg
atcaaggcctttggaaaatgtactactgaccatatttccatggcaggaccatggttgcgt
ttcagggggcatttggacaatattgccaataatactttgattggagcagtaaatgccttc
aaccaaaaaaccaacttcgttaaaaaccaaatcacaggtgagtacggaggtgttccggat
acgcagcgcgaatacaagaaaaaaggtattaagacggttgttgtgggagaccataactac
ggtgaaggttcatcaagggagcatgcggccatgcaaccaagacacttgggtgttgccgtt
gtattggtaaaatccttcgcaaggatccacgagaccaaccttaagaaacaagggatgttg
gcgttgacctttgccaatgaggacgattacgatttgattcaggaagacgatacgttcaat
attgttgatgccgctgagtttgccccggataaacctttgaccatcgaagtagtgcatgcc
gatggaagtaaggataccatcgtaacaaaccatacatacaacgatgcgcagatcaagtgg
ttcaacgaaggttcggccttgaacttgatcaagaaacagaatgcttaa

DBGET integrated database retrieval system