KEGG   Muricauda ruestringensis: Murru_2445Help
Entry
Murru_2445        CDS       T01598                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00260  Glycine, serine and threonine metabolism
mrs00750  Vitamin B6 metabolism
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01230  Biosynthesis of amino acids
Module
mrs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Murru_2445
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Murru_2445
Enzymes [BR:mrs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Murru_2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEM71483
UniProt: G2PPI2
Position
complement(2699111..2700406)
Genome map
AA seq 431 aa AA seqDB search
MKFYSLNNQNIQVSFKDAVIAGIAPDKGLYFPESITPLPADFFENIEGLSNHEIAFKAIH
QFVSEDIPDEALKEIIANTLDFDFPVVDIEDGVATLELFHGPTMAFKDVGARFMANCLGY
FSQGEKQDVTVLVATSGDTGGAVANGFLGVDGVKVVILYPSGKVSEIQEKQLTTLGQNIE
AMEVDGTFDDCQRMVKTAFLDSEITEHKKLTSANSINVARWLPQLFYFLFAYKQAKSKGK
EIVFSVPSGNFGNICAGMVAQKLGMPVKHFVASTNVNDVVPKFMKNGIYEPMPSVATISN
AMDVGDPSNFVRIRHLHQDDLAILQKHLSSYAFTDEATRAIMKEVYSKTGYVMDPHGAVG
YLGLKEYQKSHPDTYGIFLETAHPVKFLDVVEETLGLSPEIPPQIMKVMHKQKKSHQISE
YENLKSYLLDN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctacagtttaaacaaccaaaacatacaagtttctttcaaggatgcggtcatt
gcgggaatagcacccgataaagggctttattttccagaaagcatcactccccttcctgct
gatttttttgagaacattgaggggctttccaatcacgagatagcgttcaaggctatccat
caatttgtgagtgaagatataccagatgaagctttgaaggaaatcattgccaacactttg
gattttgattttcccgtagtcgatattgaagatggtgtagccactttggaactttttcat
ggccctactatggctttcaaagatgtaggcgcgcgttttatggccaactgccttggatac
ttttcccaaggcgaaaaacaagacgtcaccgttttggtggccacttcgggagataccggt
ggtgccgttgccaatggctttttaggtgttgatggtgtaaaggtcgttatcctctaccct
agcggaaaagtgagcgagatacaagaaaagcaattgaccacattgggtcaaaatattgag
gccatggaggttgatggcacttttgacgattgccaacgcatggtaaaaacagcttttttg
gattcggaaatcacggagcacaaaaaattgacttcggcaaatagtatcaacgtggccaga
tggttgccccaattgttctattttttgtttgcctacaaacaggcaaaatccaaagggaaa
gaaattgtgttttcggtaccatcaggcaattttggaaatatttgtgcagggatggtcgcc
caaaaattgggtatgcccgtcaaacattttgtggcatccaccaatgtaaatgatgtggtg
cccaaattcatgaaaaacggaatttatgaacccatgccttccgtcgcaacaatttctaat
gctatggatgtgggtgacccgagcaattttgtccgcatcaggcatttgcaccaagatgat
ttggctatacttcaaaagcatctttcctcctacgcttttacggatgaagccaccagagca
atcatgaaagaagtatattccaaaacagggtacgttatggacccgcatggtgccgttggg
taccttggactaaaggaatatcaaaaatcccatccggatacctatggtattttcttggaa
actgcccatcccgttaaattcttggacgtagttgaagaaactttagggttaagtccagag
attcccccacaaatcatgaaggtaatgcacaaacaaaaaaagtcgcatcaaatttctgaa
tacgaaaatctaaaatcctatttgctcgataattag

DBGET integrated database retrieval system