KEGG   Muricauda ruestringensis: Murru_2647Help
Entry
Murru_2647        CDS       T01598                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mrs  Muricauda ruestringensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mrs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2915989..2916636
Genome map
AA seq 215 aa AA seqDB search
MKPADQSRTSTVTQVNGTLCNGENGQRLKKNDKIAEIAHHFGRIMEVLGLDLDDPSLKDT
PARVAKMFVNEAFVGLDETQFPEVSFFDNTYNFDEMVVVNDISLYSYCEHHFVPFFGKVN
VAYFPNKKVIGLSKINRIVDFIGRKPQVQEKLTREIAETLSVLLDTEHVAVYVEANHLCV
ASRGIKDHNSHTKTGSYLGKFKNEWTKKEFVSTFQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctgctgaccaaagcaggacaagcactgtgacccaggtcaatggaacgttgtgc
aatggagagaacggtcaacgtctaaagaagaatgataaaattgccgaaatcgcccatcat
tttggaaggataatggaagtgctcgggctggacctggatgaccctagcttaaaggatact
ccggcacgggtcgcaaaaatgtttgtaaatgaagcttttgtcggtttggatgagacccaa
tttcccgaagtgtccttttttgacaatacctacaactttgacgaaatggtggttgtcaac
gacattagtctgtattcctattgcgagcaccactttgtgccctttttcggaaaggtgaat
gttgcatattttccgaataaaaaggtcattgggctttccaagattaataggatcgtggac
tttatcggtagaaagccacaggtccaggaaaaattgaccagggaaatcgcagagacctta
tccgtgcttttggacacggaacatgtggccgtatatgtggaggccaaccatctttgcgtg
gcctcgaggggcatcaaggaccataacagccatacaaagacggggagttatctggggaag
ttcaaaaatgaatggaccaaaaaagagttcgtgtcgactttccaataa

DBGET integrated database retrieval system