KEGG   Muricauda ruestringensis: Murru_2832Help
Entry
Murru_2832        CDS       T01598                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mrs  Muricauda ruestringensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Murru_2832
Enzymes [BR:mrs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Murru_2832
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Murru_2832
Lipid biosynthesis proteins [BR:mrs01004]
 Fatty acid synthase
  Component type
   Murru_2832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3120761..3121462)
Genome map
AA seq 233 aa AA seqDB search
MTKKTPSFPLPLMFCYFLSLLLLGCGEKNAKKDTDEVSATQETTVTETGDSNKKILFFGD
SLTAGYGLEVSQAFPALIQQKIDSLELDYTVINAGLSGETTASGKNRLEWVLEDGIDIII
IELGANDGLRGVPLTETESNLQSMVDTVQSKLPNAKIILAGMKIPPNMGPEYTSKFESLF
PELASSENITLIPFLLENVAGIPELNQGDGIHPTVAGQKLVAENVWEVLGPML
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaaaccccgagcttcccattaccgttaatgttttgttattttttatcgcta
ctactccttggttgtggggaaaagaacgctaaaaaagatactgatgaagtttcggccact
caagaaacaacagttaccgagaccggtgattcgaacaagaaaatcctgttttttggcgac
agtcttaccgctggctacggtttggaggtcagtcaagccttcccggcacttatccaacaa
aaaatagactctttggaattggattataccgtgatcaatgcaggattgagcggcgaaact
acggcaagcggtaaaaataggttggaatgggttctggaagatggtatagacatcatcatc
atagaattgggtgccaatgatgggctacggggtgtcccgcttacggaaacggaatcgaat
cttcaaagtatggtggacaccgtccaaagcaaattacccaatgccaagattattctggca
ggaatgaagatcccaccgaacatgggccccgaatacacttctaaatttgagagcctattt
ccggagttggcatcttcggaaaacataacattgattccttttttattggaaaacgtagcc
ggtattcccgaactcaatcaaggggatggcattcatccaactgtagcgggacaaaagttg
gtggctgaaaatgtttgggaggttttagggccaatgctctaa

DBGET integrated database retrieval system