KEGG   Muricauda ruestringensis: Murru_3061Help
Entry
Murru_3061        CDS       T01598                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00790  Folate biosynthesis
mrs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Murru_3061
Enzymes [BR:mrs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Murru_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEM72082
UniProt: G2PKN6
Position
3380828..3381427
Genome map
AA seq 199 aa AA seqDB search
MAPYRNLEEYNIEITNEVKEHFSKIVEDIGEDVTREGLLKTPERAAKAMLFLTQGYKQNA
EEILKGAMFAEDYDDMVIIKDIELYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRIVD
VFARRLQVQERLTHDILECINKTLKPKGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGQ
FEKIETRNEFLKLISSDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctatagaaacctcgaagagtataatattgaaattaccaatgaggtaaaagag
catttctcaaaaatagtggaggatattggggaggatgtaacccgagaggggcttttaaaa
acacctgaacgtgccgcaaaagctatgcttttcttaacgcaaggttacaaacaaaatgca
gaggaaattcttaaaggcgccatgtttgcagaggattatgacgatatggtcataataaag
gatattgagctttattcgctttgtgagcaccacatgctgccattttttggcaaagcccat
gtagcttacatccccaacggacatattgtaggtttgagcaaaattccccgaatagtagat
gtttttgcccgtaggttgcaggtgcaggaacggttgacgcacgatattctggaatgcatc
aacaaaacattaaaacccaaaggcgttgccgttgtaatagaagccgcccacatgtgcatg
atgatgcgcggtgtgcaaaaacaaaattctgtgacgacaacctcgggttttagaggacaa
tttgaaaaaattgagacccgaaacgaatttttaaagctgattagctccgatttgtcataa

DBGET integrated database retrieval system