KEGG   Muricauda ruestringensis: Murru_3061Help
Entry
Murru_3061        CDS       T01598                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mrs  Muricauda ruestringensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Murru_3061
Enzymes [BR:mrs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Murru_3061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3380828..3381427
Genome map
AA seq 199 aa AA seqDB search
MAPYRNLEEYNIEITNEVKEHFSKIVEDIGEDVTREGLLKTPERAAKAMLFLTQGYKQNA
EEILKGAMFAEDYDDMVIIKDIELYSLCEHHMLPFFGKAHVAYIPNGHIVGLSKIPRIVD
VFARRLQVQERLTHDILECINKTLKPKGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGQ
FEKIETRNEFLKLISSDLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctatagaaacctcgaagagtataatattgaaattaccaatgaggtaaaagag
catttctcaaaaatagtggaggatattggggaggatgtaacccgagaggggcttttaaaa
acacctgaacgtgccgcaaaagctatgcttttcttaacgcaaggttacaaacaaaatgca
gaggaaattcttaaaggcgccatgtttgcagaggattatgacgatatggtcataataaag
gatattgagctttattcgctttgtgagcaccacatgctgccattttttggcaaagcccat
gtagcttacatccccaacggacatattgtaggtttgagcaaaattccccgaatagtagat
gtttttgcccgtaggttgcaggtgcaggaacggttgacgcacgatattctggaatgcatc
aacaaaacattaaaacccaaaggcgttgccgttgtaatagaagccgcccacatgtgcatg
atgatgcgcggtgtgcaaaaacaaaattctgtgacgacaacctcgggttttagaggacaa
tttgaaaaaattgagacccgaaacgaatttttaaagctgattagctccgatttgtcataa

DBGET integrated database retrieval system