KEGG   Muricauda ruestringensis: Murru_3113Help
Entry
Murru_3113        CDS       T01598                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mrs  Muricauda ruestringensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mrs01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mrs00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3428318..3429601
Genome map
AA seq 427 aa AA seqDB search
MQRINYPQQSDWAEILKRPTQTVSDIEEIVNSIFKEVKSDGDTVIKKCTDRFDQVKLDAL
SVSPSEIKIANDAVSDALKQAINLAKVNIEKFHAAQKTSKVEVETMPGVECWQEKRPIQK
VGLYIPGGTAPLFSTILMLAIPAKLAGCEEIVLCTPPDKNGEINPAILYTAQLCGVTRIF
KVGGIQAIAGMTFGTESIPKVYKIFGPGNQYVTVAKQLATKYGVAIDMPAGPSELLVVAD
DSANAAFVASDLLSQAEHGVDSQVILVSTSEKLIEAVEEEIESQLQQLPRAEIARKSIGN
SRLILVKNDQEAMDLINEYGPEHFIVCMGNEAFYLENIQNAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFMKSMTFQKISEKGIQGIGSAIELMAEAEGLQAHKNAVT
LRLKSLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtatcaattatccacagcaaagtgattgggccgaaatattgaagcgacccacg
caaactgtttccgatattgaagaaattgtcaacagtatttttaaagaggtgaaatctgat
ggcgataccgttatcaaaaagtgtacagaccggtttgaccaagtgaagttggatgcactt
tcggtatctccttcagaaattaaaatagctaatgatgccgtttcagatgccctaaaacaa
gctatcaacctagcaaaggtcaatatcgaaaaattccatgcagctcaaaaaacttccaaa
gttgaagtagaaacgatgcctggtgtggaatgctggcaggaaaaacgccctattcaaaaa
gtaggtttgtacatacccggcggcacagctcccttattttctactattttgatgttggca
attccggctaaattggctggttgtgaggaaattgtactctgcaccccacccgataaaaat
ggagaaatcaatccagcgattttatacacggcccaactttgtggcgtaacacggattttt
aaagttggcggtattcaggctattgcaggaatgacctttggtacggaaagcatcccaaaa
gtgtataaaatatttggtccgggaaaccaatatgtgaccgttgccaagcaattggccact
aaatatggggtagcgatagatatgccagcggggccaagtgagcttttggtggttgcggat
gattcagcgaacgctgcttttgtagcttcggatttgttaagtcaagccgaacacggggtg
gacagtcaggtaattttggtatccacttcagaaaaattgattgaggcagttgaagaggaa
atcgaaagtcagctacagcagttgccgagagcggaaatagctcgcaaatcgattggcaat
agtagattgattttggtgaagaatgaccaagaagctatggatttgatcaatgaatatggt
ccggagcactttattgtttgtatgggaaatgaggcgttttacctcgaaaacatccagaat
gcgggctctgtgtttatcggcaattatacgcccgagagtgcaggtgattacgcttcgggc
accaatcataccctgcctaccaacggatatgccaagcaatacagcggggtgaatctggat
agttttatgaagagcatgacttttcaaaaaatatccgaaaagggaatccaaggcatcgga
agtgccatagagcttatggcagaggccgagggattacaggcgcacaaaaatgcggtaacc
ttacgattgaaaagtttgaaataa

DBGET integrated database retrieval system