KEGG   Muricauda ruestringensis: Murru_3123Help
Entry
Murru_3123        CDS       T01598                                 

Definition
magnesium chelatase subunit ChlI family protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mrs  Muricauda ruestringensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Murru_3123
Enzymes [BR:mrs01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Murru_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3436987..3438456
Genome map
AA seq 489 aa AA seqDB search
MNLDHTKITTLGELKSAGYTSRSIKDELRENLLEKISKKEQVFEGVWGYENSVIPELERA
ILSRHNINLLGLRGQAKTRLARLMVQLLDEWMPIVEGSEIHDDPLEPISRYATELIKEKG
DDTPISWVHRSERFYEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANR
CIFVINELPDLQARIQVALFNILQEGDIQIRGFKLRLHLDIQFVFTANPEDYTNRGSIVT
PLKDRIGSQILTHYPESIEIAKKITKQEAQLDKRQSDFVYVPEIAMDLLEQISFEARKSE
YVDAKSGVSARMSITAFENLLSTAERRAIVAGDRKTSVRLSDFMGVVPSITGKIELVYEG
EQEGAGSVAENLIEDAAKSLFPNYFPKIDKLQRKEEENEYDELVSWFFDGEGFDLLDDEK
EENYKSKLDSIGPLNNLLKEYQPDAPKEDSYFLKELLLWGLVAYKKLSKHRFQQGYQFKD
LYGSYIRGL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggatcataccaaaattacaacgctaggtgaattaaaatcagcgggatataca
agcagaagcatcaaagacgaactccgggaaaatcttttggagaaaatatccaagaaagaa
caggtgttcgaaggggtttggggttatgaaaattccgtaattccggaattggaaagagcc
attctttcccgtcacaatattaatttattgggcttgcgcggacaggcaaagacccgtttg
gcccgtttaatggtacaactgcttgatgaatggatgcccattgtggaaggctctgaaatc
cacgatgaccctttggaacctatttcaagatacgccaccgagctgattaaagaaaaagga
gatgacactcccataagttgggtacaccgaagcgaacgtttttacgaaaagctggccaca
cccgatgtaaccgtagcggatttgataggtgatgttgacccgataaaagcggctaacctt
aaactatcctatgctgatgatcgtgtaatccattttggaatgatcccacgggccaaccgc
tgtatttttgtaatcaatgaacttcctgatcttcaagcaaggattcaagtggctttattt
aatattttacaagaaggggatatacaaattcgaggatttaaacttcgattgcatttggac
attcaatttgtatttaccgccaaccctgaagattatacgaacagaggaagcattgtaact
ccattgaaggatagaatcggttcccagattcttacccattatcccgagagtatcgaaatt
gcaaagaaaattacgaaacaagaagcgcaattggataaacgacaatctgattttgtgtat
gtacctgaaatcgcgatggatttattggagcaaatcagttttgaggccagaaaaagtgag
tatgttgatgccaaaagtggtgtgagtgcacgtatgagcatcaccgcatttgaaaattta
ttgagtactgcagagcgcagggccattgttgctggagacagaaaaacatcagttcgtctc
agtgattttatgggcgtagtgccatccatcacaggaaaaatagaattggtgtacgaagga
gagcaagagggagcgggttctgtggcggaaaacttaattgaggatgcggcaaagtcattg
ttcccgaattacttccctaaaattgataaacttcagcgcaaagaggaggaaaacgaatac
gatgaattggtcagttggttttttgatggcgagggtttcgaccttttagatgatgaaaaa
gaagaaaactacaaatcaaaattggattccattggccctttgaacaatcttttaaaggag
tatcaacccgatgcccccaaagaagattcttattttttgaaggaactgctgctctgggga
ttggttgcctataaaaagttgagcaaacaccgctttcagcaaggatatcagtttaaagat
ttgtatggaagttacattcgaggactgtaa

DBGET integrated database retrieval system