KEGG   Muricauda ruestringensis: Murru_3327Help
Entry
Murru_3327        CDS       T01598                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mrs  Muricauda ruestringensis
Pathway
mrs00010  Glycolysis / Gluconeogenesis
mrs00052  Galactose metabolism
mrs00500  Starch and sucrose metabolism
mrs00520  Amino sugar and nucleotide sugar metabolism
mrs00521  Streptomycin biosynthesis
mrs01100  Metabolic pathways
mrs01110  Biosynthesis of secondary metabolites
mrs01120  Microbial metabolism in diverse environments
mrs01130  Biosynthesis of antibiotics
mrs01200  Carbon metabolism
Module
mrs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Murru_3327
   00052 Galactose metabolism
    Murru_3327
   00500 Starch and sucrose metabolism
    Murru_3327
   00520 Amino sugar and nucleotide sugar metabolism
    Murru_3327
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Murru_3327
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Murru_3327
Enzymes [BR:mrs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Murru_3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hexokinase_2 Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEM72344
UniProt: G2PMZ6
Position
complement(3660081..3660926)
Genome map
AA seq 281 aa AA seqDB search
MEKENRTVLGVDVGGTKIKAGRVLGKDVVQSSLSKVNRDDSEETSLSKLFNTIDAVLTDD
VEAIGIGVPAVVDPDSGVVYDVQNIPAWKKVPLKALVQKQFNVPVHLNNDANCFALGEKH
FGKAKQYTNCVALSLGTGLGMGILIDNKLYNGVLCGAGEVGMLPYKNGIMEQYAGSFFFE
REYGESAKVLYQKALDKNEIALTAFREYGVHLGEALKAILYLFAPESIILGGSISSAYPF
FKTSLQEAIDSFAYQKQLENFKIETSDLVDSPILGAAALGL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaagaaaataggacagttttaggggttgatgtaggaggtactaaaatcaaagcg
ggaagagttttgggaaaggatgtggtacaaagcagtctttccaaagtaaatcgggatgat
tcagaggagacttccctctcaaaattatttaataccattgatgcggtcctgaccgacgat
gttgaagctattgggattggggttcctgcagttgttgacccagattctggtgttgtatat
gatgtgcagaacattccagcatggaaaaaagtccctttaaaagcgcttgtacaaaagcaa
tttaatgttccggtgcatttaaataatgatgccaattgttttgcgcttggcgaaaaacat
tttgggaaggcgaagcaatataccaattgtgtggcactttctttaggtaccggactcggt
atgggaattttaatagacaataagttatacaacggcgttttgtgcggtgctggtgaagtg
ggcatgcttccttacaaaaatggcattatggaacaatatgcaggaagcttcttttttgaa
agggaatatggagagtctgccaaagtcctttatcaaaaagcattggataaaaatgaaatt
gccttgaccgcctttagggaatacggggtgcatttgggggaagccttaaaggccattctc
tatttatttgctcctgaatctataatacttggtgggtccataagcagtgcctatccattt
tttaaaacttcgttgcaagaggctatcgattcgtttgcctatcaaaaacaattggaaaat
tttaaaatcgaaacatcagatttggtggattcacccattttgggtgcagccgcactaggt
ctgtaa

DBGET integrated database retrieval system