KEGG   Methanobrevibacter ruminantium: mru_0211Help
Entry
mru_0211          CDS       T01166                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01130  Biosynthesis of antibiotics
mru01230  Biosynthesis of amino acids
Module
mru_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_0211 (trpC)
Enzymes [BR:mru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     mru_0211 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADC46063
UniProt: D3DZA8
Position
336920..337696
Genome map
AA seq 258 aa AA seqDB search
MLKKIVAKTEERLIEAKKIKSLDKLKEEVSKLEINNEFPFKEALKDPEIAIIAEVKKASP
SKGLIAEDFDYIKIAKEYEQAGASAISVLTEPYFFQGSNDFLKEISQNVSIPLLRKDFTI
DEYMIYEAKILGASAILLIVSILDNVQLKNYLDLAHDLGLSAIVETHDADEIRTAVDAGA
GIIGVNNRNLADFTVDIENSIRLRSLVSDKILFISESGIKTAEDVGRLKKNNVDAVLIGE
TLMRSDDKKSMILELKNG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagaagatagttgctaaaactgaagagagattaattgaagctaaaaagattaaa
tccttagataagctaaaagaggaagtatcaaagttagaaataaataatgaattccctttt
aaagaagccttaaaagaccctgaaattgctatcattgctgaagttaagaaagcatctcct
tcaaaaggattaattgccgaagactttgattatatcaagatagcaaaggaatatgagcaa
gctggagcttctgcaatatcagtcctaacagagccatatttcttccaaggatccaacgat
ttcctaaaggaaatttctcaaaatgtatcaattcctcttttaagaaaggattttaccatt
gatgagtatatgatatatgaagcaaagatattaggtgcttctgccatccttttgattgtt
tcaatacttgataatgttcaattaaagaattacttggatttggcacatgatttaggtctc
tccgcaattgttgaaacccacgatgcagatgaaataagaactgcagtagatgccggtgca
gggataattggagtaaacaatagaaatttagctgattttacagtagatattgaaaatagc
atcagattaagaagtcttgtaagcgataagatcctattcatttccgaaagcggtatcaaa
acagctgaagatgtaggcagactaaagaaaaacaatgtggatgcagttttaatcggtgaa
actttaatgagaagtgatgataagaaatctatgattttggagttgaagaatggttag

DBGET integrated database retrieval system