KEGG   Methanobrevibacter ruminantium: mru_0213Help
Entry
mru_0213          CDS       T01166                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta subunit TrpB1 (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mru_0213 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_0213 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_0213 (trpB1)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mru_0213 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
338576..339760
Genome map
AA seq 394 aa AA seqDB search
MSRGRFGVHGGQYMSETLMNELLNLEKQYNHFKEDPEFIEELNTLLKEYAGRPSLLYYAK
RMTEDLGGAKIYLKREDLNHTGAHKINNVLGQCLLAKKMGKTRVIAETGAGQHGVATATA
AALLDMECEVFMGEEDTKRQALNVFRMELLGAKVHTVTTGSKVLKDAVNDAFREWISRVD
DTHYVIGSTMGPHPFPTIVRDFQAVISQEMKEQILELEGKLPNMVIACVGGGSNAMGSFY
NFLDDEEVELVGVEAAGKGIDTEYHAATIAKGELGIFHGMKSYFCQGNYGQIAPVYSISA
GLDYPGIGPEHAYLHDIGRAKYVSATDDEAVEAFEYLSRTEGIIPAIESSHAIAHAMRVA
GDMDKDDIIIINVSGRGDKDVAAIARYKGVELYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtcgatttggagttcatggtggacaatacatgtctgaaaccttaatgaat
gaacttcttaacttagaaaaacaatataatcattttaaagaagaccctgaatttatagaa
gagttaaacactcttttaaaggaatatgcaggaaggccttctttattatactatgcaaaa
agaatgacagaggatcttggaggagcaaagatctatctaaagcgtgaagacttaaaccat
actggtgcacataagataaacaatgttcttggacagtgtctgcttgctaaaaagatgggc
aaaaccagagtgattgcagaaaccggtgcaggtcagcatggtgttgcaacagctactgct
gcagccttattggacatggaatgtgaagtctttatgggtgaagaggacacaaagcgtcaa
gcattgaatgtattccgtatggaacttctaggagctaaggttcatacagtaacaacaggc
tctaaagtccttaaggatgcagtaaacgatgcttttagagaatggatttcaagagtggat
gacacccattatgtaataggttccactatgggtccacatccatttccaactatagttcgg
gactttcaggcagtgataagtcaggaaatgaaagaacagattctagagctagaaggcaag
cttccaaatatggttattgcctgtgtcggtggaggaagcaatgcgatgggttcattttac
aatttcctggatgatgaggaagtggagctggttggagttgaagctgcaggaaagggaata
gacactgaataccatgcggctacaattgcaaaaggagagcttggaatattccatggaatg
aaatcctatttctgccaaggcaattatggtcagattgctcctgtatattcaatatcagca
ggtcttgactatcctggaattggtcctgaacatgcctatttgcatgatataggaagagca
aaatatgtctcagctaccgacgatgaggcagtggaagcctttgaatacctatcaagaacg
gaaggaatcattccagcaatagaatcctcccatgcaatagcccatgcaatgagggttgca
ggagatatggataaggatgatataatcatcattaatgtttcaggtcgtggagataaggat
gtggcagctattgcccgatataagggagttgaattatacgaataa

DBGET integrated database retrieval system