KEGG   Methanobrevibacter ruminantium: mru_0213Help
Entry
mru_0213          CDS       T01166                                 

Gene name
trpB1
Definition
tryptophan synthase beta subunit TrpB1 (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mru_0213 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_0213 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_0213 (trpB1)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mru_0213 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338576..339760
Genome map
AA seq 394 aa AA seqDB search
MSRGRFGVHGGQYMSETLMNELLNLEKQYNHFKEDPEFIEELNTLLKEYAGRPSLLYYAK
RMTEDLGGAKIYLKREDLNHTGAHKINNVLGQCLLAKKMGKTRVIAETGAGQHGVATATA
AALLDMECEVFMGEEDTKRQALNVFRMELLGAKVHTVTTGSKVLKDAVNDAFREWISRVD
DTHYVIGSTMGPHPFPTIVRDFQAVISQEMKEQILELEGKLPNMVIACVGGGSNAMGSFY
NFLDDEEVELVGVEAAGKGIDTEYHAATIAKGELGIFHGMKSYFCQGNYGQIAPVYSISA
GLDYPGIGPEHAYLHDIGRAKYVSATDDEAVEAFEYLSRTEGIIPAIESSHAIAHAMRVA
GDMDKDDIIIINVSGRGDKDVAAIARYKGVELYE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtcgatttggagttcatggtggacaatacatgtctgaaaccttaatgaat
gaacttcttaacttagaaaaacaatataatcattttaaagaagaccctgaatttatagaa
gagttaaacactcttttaaaggaatatgcaggaaggccttctttattatactatgcaaaa
agaatgacagaggatcttggaggagcaaagatctatctaaagcgtgaagacttaaaccat
actggtgcacataagataaacaatgttcttggacagtgtctgcttgctaaaaagatgggc
aaaaccagagtgattgcagaaaccggtgcaggtcagcatggtgttgcaacagctactgct
gcagccttattggacatggaatgtgaagtctttatgggtgaagaggacacaaagcgtcaa
gcattgaatgtattccgtatggaacttctaggagctaaggttcatacagtaacaacaggc
tctaaagtccttaaggatgcagtaaacgatgcttttagagaatggatttcaagagtggat
gacacccattatgtaataggttccactatgggtccacatccatttccaactatagttcgg
gactttcaggcagtgataagtcaggaaatgaaagaacagattctagagctagaaggcaag
cttccaaatatggttattgcctgtgtcggtggaggaagcaatgcgatgggttcattttac
aatttcctggatgatgaggaagtggagctggttggagttgaagctgcaggaaagggaata
gacactgaataccatgcggctacaattgcaaaaggagagcttggaatattccatggaatg
aaatcctatttctgccaaggcaattatggtcagattgctcctgtatattcaatatcagca
ggtcttgactatcctggaattggtcctgaacatgcctatttgcatgatataggaagagca
aaatatgtctcagctaccgacgatgaggcagtggaagcctttgaatacctatcaagaacg
gaaggaatcattccagcaatagaatcctcccatgcaatagcccatgcaatgagggttgca
ggagatatggataaggatgatataatcatcattaatgtttcaggtcgtggagataaggat
gtggcagctattgcccgatataagggagttgaattatacgaataa

DBGET integrated database retrieval system