KEGG   Methanobrevibacter ruminantium: mru_0214Help
Entry
mru_0214          CDS       T01166                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00260  Glycine, serine and threonine metabolism
mru00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01130  Biosynthesis of antibiotics
mru01230  Biosynthesis of amino acids
Module
mru_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_0214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_0214 (trpA)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mru_0214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA Radical_SAM Glyco_tran_WecB DUF1722
Motif
Other DBs
NCBI-ProteinID: ADC46066
UniProt: D3DZB1
Position
339810..340592
Genome map
AA seq 260 aa AA seqDB search
MEKDIKISDAFKDGKAFIGFLTAGDPTIEKTVEYVLAMEEAGCDLVEIGIPFSDPVAEGP
VIQEANIRALSNNTNTDDVFEAIRQIREKSDVPLVFLTYINPVFYYGYDKFFKRCQELNV
CGIISPDLPYDEKDEILEVTKKYGVDIISLIAPTSKERIQMIASEASGFIYVVSSLGVTG
MRSEIRTDLKSIISDIKEVTDVPTAVGFGINTPEQAKNISKVADGVIVGSAIVNIIAEHG
ENAREPLANYVKSMKDAISK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagatataaagattagcgatgcatttaaagatggaaaagctttcatcggattt
ttaaccgctggagatcctacaattgaaaagacagttgaatatgtgctggcaatggaagag
gcaggttgcgaccttgtagagattggaattcctttctcagaccctgtagctgaagggcca
gtcattcaggaagcaaatataagggcactatcaaacaatacaaacactgatgatgtcttt
gaggcaataagacaaataagagaaaagtcagatgttcctttagtatttctaacttacatc
aatccagtgttctattatggatatgacaagttcttcaaaagatgccaggaacttaatgtc
tgtggaataatatctccagaccttccatatgatgaaaaggatgagatattggaggtaaca
aagaaatatggtgttgatataattagcctgattgcacctacttcaaaggaacgcatacaa
atgattgcaagtgaagcaagtggatttatctatgttgtttcatcattaggagtcactggt
atgagaagtgagattaggacggatttaaaatcaataattagtgatataaaggaagttact
gatgttccaacagctgttggttttggtatcaacactccagaacaagctaaaaatatctca
aaagttgcagatggtgttattgtagggagtgcaattgttaatattattgcagagcatggg
gaaaatgcaagagagcctcttgcaaattatgttaaatcaatgaaagatgctatttccaag
tag

DBGET integrated database retrieval system