KEGG   Methanobrevibacter ruminantium: mru_0214Help
Entry
mru_0214          CDS       T01166                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit TrpA (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mru_0214 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_0214 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_0214 (trpA)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mru_0214 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
339810..340592
Genome map
AA seq 260 aa AA seqDB search
MEKDIKISDAFKDGKAFIGFLTAGDPTIEKTVEYVLAMEEAGCDLVEIGIPFSDPVAEGP
VIQEANIRALSNNTNTDDVFEAIRQIREKSDVPLVFLTYINPVFYYGYDKFFKRCQELNV
CGIISPDLPYDEKDEILEVTKKYGVDIISLIAPTSKERIQMIASEASGFIYVVSSLGVTG
MRSEIRTDLKSIISDIKEVTDVPTAVGFGINTPEQAKNISKVADGVIVGSAIVNIIAEHG
ENAREPLANYVKSMKDAISK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagatataaagattagcgatgcatttaaagatggaaaagctttcatcggattt
ttaaccgctggagatcctacaattgaaaagacagttgaatatgtgctggcaatggaagag
gcaggttgcgaccttgtagagattggaattcctttctcagaccctgtagctgaagggcca
gtcattcaggaagcaaatataagggcactatcaaacaatacaaacactgatgatgtcttt
gaggcaataagacaaataagagaaaagtcagatgttcctttagtatttctaacttacatc
aatccagtgttctattatggatatgacaagttcttcaaaagatgccaggaacttaatgtc
tgtggaataatatctccagaccttccatatgatgaaaaggatgagatattggaggtaaca
aagaaatatggtgttgatataattagcctgattgcacctacttcaaaggaacgcatacaa
atgattgcaagtgaagcaagtggatttatctatgttgtttcatcattaggagtcactggt
atgagaagtgagattaggacggatttaaaatcaataattagtgatataaaggaagttact
gatgttccaacagctgttggttttggtatcaacactccagaacaagctaaaaatatctca
aaagttgcagatggtgttattgtagggagtgcaattgttaatattattgcagagcatggg
gaaaatgcaagagagcctcttgcaaattatgttaaatcaatgaaagatgctatttccaag
tag

DBGET integrated database retrieval system