KEGG   Methanobrevibacter ruminantium: mru_0246Help
Entry
mru_0246          CDS       T01166                                 

Definition
carbohydrate kinase PfkB family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    mru_0246
Enzymes [BR:mru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     mru_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
388763..389680
Genome map
AA seq 305 aa AA seqDB search
MTIKKDLLAIGHTALDYIITVDEFPKANNSAPMKTMLNLNGGAAANVAMIGASLGLKSGL
VSAVGKEFIDSHYHKEMTRLGVDTEAMIISETENTPTAFVMTNKNQDQISYFYWGAGKDF
HDSEVPREKIKEFKAVHLATGDPHFNCKSGIVAKEEERLVSFDPGQDLGMYSPKKLKEVI
SNSNILFGNHHEIKRIQESLAVDINGLMELGPEIVLTTCGKEGSIIYSLDEGKFEIDSIY
RPAVDPTGAGDSYKAGFLSQFINGKTLEESAKFASSVSSFVVEKQGCQTNMPSYEDAYNR
MMDFY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgactattaaaaaagacttattagcgataggacatactgcattggattatataatcaca
gtagatgaatttccaaaggctaacaattcagctcctatgaagaccatgctaaacttgaat
gggggagctgcagctaatgtggctatgattggcgcaagccttggattgaaatctggattg
gtatccgctgtaggtaaggaatttattgactctcattatcataaggaaatgaccagatta
ggtgttgacactgaagcgatgattatttcagagactgaaaacacacctactgcttttgtt
atgacaaataaaaatcaggaccagattagctatttctactggggagcaggtaaggatttc
catgatagtgaagttccaagggaaaagataaaggaatttaaggcagttcatttggcaact
ggagatcctcatttcaattgcaaatctggaatcgttgcaaaggaagaggaaagattggtt
tcattcgatccaggtcaagaccttggaatgtatagtcctaaaaagcttaaggaagtcatt
agcaattcaaacattctttttggaaaccatcatgaaatcaaaaggattcaagagtcattg
gctgttgacattaacggtttgatggaattaggtccggaaattgttcttacaacttgcggt
aaggaaggaagcataatctatagccttgatgagggcaagtttgagattgattccatctat
aggcctgcagttgatcctacaggtgctggagactcctataaggcaggattcctatcccaa
tttattaatggaaagacattagaggaatctgctaagtttgcatcttctgtttcatccttt
gttgtggaaaagcaaggatgtcaaacaaacatgcctagctatgaagatgcttataataga
atgatggacttttattag

DBGET integrated database retrieval system