KEGG   Methanobrevibacter ruminantium: mru_0246Help
Entry
mru_0246          CDS       T01166                                 

Definition
(GenBank) carbohydrate kinase PfkB family
  KO
K22026  
nucleoside kinase [EC:2.7.1.73 2.7.1.213 2.7.1.-]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Purine metabolism
Pyrimidine metabolism
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    mru_0246
   00240 Pyrimidine metabolism
    mru_0246
Enzymes [BR:mru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.73  inosine kinase
     mru_0246
    2.7.1.213  cytidine kinase
     mru_0246
    2.7.1.-  
     mru_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
388763..389680
Genome map
AA seq 305 aa AA seqDB search
MTIKKDLLAIGHTALDYIITVDEFPKANNSAPMKTMLNLNGGAAANVAMIGASLGLKSGL
VSAVGKEFIDSHYHKEMTRLGVDTEAMIISETENTPTAFVMTNKNQDQISYFYWGAGKDF
HDSEVPREKIKEFKAVHLATGDPHFNCKSGIVAKEEERLVSFDPGQDLGMYSPKKLKEVI
SNSNILFGNHHEIKRIQESLAVDINGLMELGPEIVLTTCGKEGSIIYSLDEGKFEIDSIY
RPAVDPTGAGDSYKAGFLSQFINGKTLEESAKFASSVSSFVVEKQGCQTNMPSYEDAYNR
MMDFY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgactattaaaaaagacttattagcgataggacatactgcattggattatataatcaca
gtagatgaatttccaaaggctaacaattcagctcctatgaagaccatgctaaacttgaat
gggggagctgcagctaatgtggctatgattggcgcaagccttggattgaaatctggattg
gtatccgctgtaggtaaggaatttattgactctcattatcataaggaaatgaccagatta
ggtgttgacactgaagcgatgattatttcagagactgaaaacacacctactgcttttgtt
atgacaaataaaaatcaggaccagattagctatttctactggggagcaggtaaggatttc
catgatagtgaagttccaagggaaaagataaaggaatttaaggcagttcatttggcaact
ggagatcctcatttcaattgcaaatctggaatcgttgcaaaggaagaggaaagattggtt
tcattcgatccaggtcaagaccttggaatgtatagtcctaaaaagcttaaggaagtcatt
agcaattcaaacattctttttggaaaccatcatgaaatcaaaaggattcaagagtcattg
gctgttgacattaacggtttgatggaattaggtccggaaattgttcttacaacttgcggt
aaggaaggaagcataatctatagccttgatgagggcaagtttgagattgattccatctat
aggcctgcagttgatcctacaggtgctggagactcctataaggcaggattcctatcccaa
tttattaatggaaagacattagaggaatctgctaagtttgcatcttctgtttcatccttt
gttgtggaaaagcaaggatgtcaaacaaacatgcctagctatgaagatgcttataataga
atgatggacttttattag

DBGET integrated database retrieval system