KEGG   Methanobrevibacter ruminantium: mru_0339Help
Entry
mru_0339          CDS       T01166                                 

Gene name
fwdH
Definition
tungsten formylmethanofuran dehydrogenase subunit H FwdH (EC:1.2.99.5)
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mru  Methanobrevibacter ruminantium
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_0339 (fwdH)
  Energy metabolism
   00680 Methane metabolism
    mru_0339 (fwdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
493228..493677
Genome map
AA seq 149 aa AA seqDB search
MPKHIVSGLKYLESVELRKRGLSQKEISSEIGVDRSTISHYLNGRNISADSIELAKVILE
LNPKDFILIARVLFGDYNEIRQLISIFNMNHYDPQIDDGCIGCGLCVDLCEVKSISLDSL
KAKINPRYCCGCLMCVEDCPTNSIKILEV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacatatcgtatcaggactaaaatatttagaaagtgtcgagcttagaaaaaga
gggctgtcccaaaaggagatttcatctgaaattggtgtggacagatcaactatttctcac
tacttgaacggccgaaacatttctgccgattcaatcgagcttgctaaagttattttagag
ctgaatcctaaggattttatattaattgcaagagttttgtttggagattataacgaaatt
cgtcaacttattagcatttttaatatgaatcattatgacccgcagatagatgacggatgt
attggttgtggattgtgtgtagatttgtgtgaagtgaagtctattagcttagactcatta
aaagcaaagataaaccctcgttattgttgtggctgtcttatgtgtgttgaagattgcccg
acaaattcaataaagattttggaggtataa

DBGET integrated database retrieval system