KEGG   Methanobrevibacter ruminantium: mru_0449Help
Entry
mru_0449          CDS       T01166                                 

Gene name
glmM2
Definition
phosphoglucosamine mutase GlmM2 (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0449 (glmM2)
   00030 Pentose phosphate pathway
    mru_0449 (glmM2)
   00051 Fructose and mannose metabolism
    mru_0449 (glmM2)
   00052 Galactose metabolism
    mru_0449 (glmM2)
   00500 Starch and sucrose metabolism
    mru_0449 (glmM2)
   00520 Amino sugar and nucleotide sugar metabolism
    mru_0449 (glmM2)
  Nucleotide metabolism
   00230 Purine metabolism
    mru_0449 (glmM2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mru_0449 (glmM2)
Enzymes [BR:mru01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     mru_0449 (glmM2)
    5.4.2.8  phosphomannomutase
     mru_0449 (glmM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631444..632808
Genome map
AA seq 454 aa AA seqDB search
MVEKRLFGTFGVRRNCEMMVLTPEFASRLAASYGSIVQGTVAIGGDTRTSTPMLKHAITA
GLLSSGCDVVDLGILPTPAIQYAVRNYYDGGIIVTASHNPPKYNGLKFVDEFGIGTPDDM
EIEVEKLYFDEEPIRASWDKIGEVFTNESIIKEYIAETLKRVDVEAIRARKLKVVVDCGS
GAGSYTAPYILKELGCEVTTLNCQADGFFPGRDPEPIEPNLQDLIATVKNLGADIGLAHD
GDADRTICIDEKGNFILGDKTFALVEKHMLKENGGGIVVTTVATSQAIYDIAEEFGGEVI
ATAVGDLLVARKLKDTDGLFGGEENGGLIFPDFIYGRDAAMTVAKILEILVKEDKPLSEL
VAELPVYYQEKLKIECPDDQKQDVMANIANEIKDTTDFELDTTDGVKILKEDGWVIIRPS
GTEPIFRCFAESDSMDKAQEMANWGISLVEKYKN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaaaacgattatttggtacatttggtgtaagaagaaactgcgaaatgatggtg
ttgactcctgaatttgcatccagacttgccgcaagttatggatctattgtgcaagggacc
gtagccattggaggagatacaaggacaagcactccaatgcttaaacatgcaatcactgca
ggtttgctctcttcaggctgtgatgttgtggatttaggaatcctcccaactcctgctatt
caatatgcagttagaaattattatgatgggggaattattgtaacagcttcacacaatcct
ccaaaatacaatggtcttaagtttgtagatgaatttggtataggaactccagatgatatg
gaaattgaggttgaaaagctatactttgatgaggagcctattcgcgcttcttgggataag
attggtgaagtctttacaaacgaatcaatcattaaggaatatattgcagagactttaaag
agagttgatgtggaagcaatcagggcaagaaagcttaaggttgttgtagactgcggttca
ggtgcaggatcatacaccgccccatacattcttaaggaattaggatgcgaggtaaccaca
ttgaactgtcaggctgacggatttttcccaggaagggacccagagccaatagagccaaat
cttcaggacttgattgcaacagtaaagaaccttggagcagacattggacttgcccatgac
ggtgatgcagacagaaccatttgcattgatgagaaaggaaacttcatattaggagataag
acctttgcccttgttgaaaagcatatgcttaaggaaaacggtggaggaattgttgtaacc
actgtagctacctctcaagccatttatgatattgcagaagagtttggcggtgaagttatt
gcaactgctgttggagatttgcttgttgcaagaaagcttaaggatacagatggactcttt
ggaggagaagaaaacggtggactaattttcccagactttatctatggaagagatgctgcc
atgactgtggcaaagatacttgaaattcttgttaaggaagataagccattatctgaactt
gtagcagagcttccagtctattatcaggaaaagttaaagattgaatgtccagatgatcaa
aagcaagatgtcatggctaatattgcaaatgagattaaggacacaactgactttgagctt
gatacaactgacggagttaagattctaaaagaggatggctgggtaattattaggccatct
ggtaccgaaccgatattcagatgctttgctgaatctgattccatggataaggctcaagag
atggctaactggggaatcagtttagtggagaagtataagaattag

DBGET integrated database retrieval system