KEGG   Methanobrevibacter ruminantium: mru_0498Help
Entry
mru_0498          CDS       T01166                                 

Gene name
fbp
Definition
fructose 1,6-bisphosphatase Fbp (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_0498 (fbp)
   01230 Biosynthesis of amino acids
    mru_0498 (fbp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0498 (fbp)
   00030 Pentose phosphate pathway
    mru_0498 (fbp)
   00051 Fructose and mannose metabolism
    mru_0498 (fbp)
  Energy metabolism
   00680 Methane metabolism
    mru_0498 (fbp)
Enzymes [BR:mru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     mru_0498 (fbp)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     mru_0498 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685591..686691
Genome map
AA seq 366 aa AA seqDB search
MKTTVSVIKADIGSVSGHCVSHPALMEKCDEVLANALETGILEDYYITRCGDDIDLIMTH
RNGELNEEVHKTAYDAFIQATEIARDLKLYGAGQDLLSDTFSGNVKGMGPGCAEMEFKER
RSDPVIVYCMDKTEPGAFNLPIFKIFADPFNTAGLVIDPSLHDGFSFEVFDVMEHKKVVL
DCPEEMYDLLALIGSTGRYVIKRVFKKNGEIAAAVSTDKLNMLAGEYVGKDDPVAIVRAQ
SGFPANGECVEPFAFPHMVSGWMRGSHNGPMMPTSQEEANPIRFDGPPRVVGLGFQVTDA
KLVGPVDLFDDPAFDETRRQSANIATYIRRHGPFEPHRLPSEEMEYTSLPGVMEKLEPRF
EDMDDD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactactgtaagtgtaatcaaagcggatattggaagtgtttccggacactgtgta
tctcatcctgcattaatggaaaaatgtgatgaggttttagctaatgctttagaaactgga
attcttgaagattactatataacccgttgtggtgacgacattgatttaatcatgacccac
agaaacggtgaattgaacgaagaagttcacaaaactgcatatgatgctttcattcaagca
actgaaattgcaagagacttaaaattatacggtgcaggtcaagacttattatctgacact
ttctctggaaacgttaaaggtatgggtccaggctgtgcagaaatggaatttaaagaaaga
agaagtgaccctgtaattgtatactgtatggataagactgaacctggtgcattcaacttg
cctatattcaagatctttgcagacccattcaacactgcaggacttgtaattgacccaagt
ttacatgacggattcagttttgaagtctttgatgtaatggaacacaaaaaagtagtatta
gactgtcctgaagaaatgtacgacttacttgcattaatcggttccactggaagatacgta
attaaaagagtatttaagaaaaacggtgaaatcgcagcagcagtaagtactgacaaatta
aacatgttagctggtgaatacgttggtaaagacgaccctgtagctattgtaagagctcaa
tctggtttccctgctaatggtgaatgtgtagaaccatttgcattccctcacatggtaagt
ggatggatgagaggttcccacaacggtcctatgatgccaaccagccaagaagaagctaac
ccaatcagatttgacggacctcctagggttgtaggtttaggtttccaagtaactgatgct
aaattagtcggtcctgtagacttatttgacgaccctgcatttgatgaaaccagaagacaa
tctgcaaacattgcaacctacatcagaagacacggtccattcgaaccacacagattacca
tctgaagagatggaatacacttcattacctggcgtaatggaaaaattagaacctaggttc
gaagatatggatgatgactaa

DBGET integrated database retrieval system