KEGG   Methanobrevibacter ruminantium: mru_0548Help
Entry
mru_0548          CDS       T01166                                 

Gene name
porC
Definition
pyruvate ferredoxin oxidoreductase gamma subunit PorC
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_0548 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0548 (porC)
   00020 Citrate cycle (TCA cycle)
    mru_0548 (porC)
   00620 Pyruvate metabolism
    mru_0548 (porC)
   00640 Propanoate metabolism
    mru_0548 (porC)
   00650 Butanoate metabolism
    mru_0548 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_0548 (porC)
   00680 Methane metabolism
    mru_0548 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    mru_0548 (porC)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     mru_0548 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738681..739202
Genome map
AA seq 173 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINL
RYQVYNPDHVIVLDDGLLNVVDVYSGLKENGEVIINTHEKVESESHKVFDVDATGIALEI
LGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPGPIGEKNAVAAQKAYDMA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcgctttcacggacgtggaggacaaggtgctgtaactgcagcagaaatt
ttggctaaagcagcatttaaagatggtaaatactctcaagcgttcccattcttcggtgta
gaaagaaggggagctcctgttatggcatttaccagaatcgatacagagcctatcaaccta
agatatcaggtatacaatcctgaccatgtgatagttcttgacgacggtctcttaaatgtt
gtggacgtctattccggattaaaagaaaatggtgaagtaattataaacactcatgaaaaa
gtcgaatctgaaagtcacaaggtatttgatgttgatgctacaggcatcgcattggaaatt
ttaggtgtaaacatcgttaacaccattattttaggatactttgctaaaaagactggtgaa
gtaagtattaattcacttattgaagtaataaaggaaactttcccaggtccaattggagag
aaaaacgcagtggcagctcaaaaggcttatgatatggcttag

DBGET integrated database retrieval system