KEGG   Methanobrevibacter ruminantium: mru_0548Help
Entry
mru_0548          CDS       T01166                                 

Gene name
porC
Definition
pyruvate ferredoxin oxidoreductase gamma subunit PorC
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:mru01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mru00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mru00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mru00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mru00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mru00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:mru00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mru00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738681..739202
Genome map
AA seq 173 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINL
RYQVYNPDHVIVLDDGLLNVVDVYSGLKENGEVIINTHEKVESESHKVFDVDATGIALEI
LGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPGPIGEKNAVAAQKAYDMA
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaattcgctttcacggacgtggaggacaaggtgctgtaactgcagcagaaatt
ttggctaaagcagcatttaaagatggtaaatactctcaagcgttcccattcttcggtgta
gaaagaaggggagctcctgttatggcatttaccagaatcgatacagagcctatcaaccta
agatatcaggtatacaatcctgaccatgtgatagttcttgacgacggtctcttaaatgtt
gtggacgtctattccggattaaaagaaaatggtgaagtaattataaacactcatgaaaaa
gtcgaatctgaaagtcacaaggtatttgatgttgatgctacaggcatcgcattggaaatt
ttaggtgtaaacatcgttaacaccattattttaggatactttgctaaaaagactggtgaa
gtaagtattaattcacttattgaagtaataaaggaaactttcccaggtccaattggagag
aaaaacgcagtggcagctcaaaaggcttatgatatggcttag

DBGET integrated database retrieval system