KEGG   Methanobrevibacter ruminantium: mru_0549Help
Entry
mru_0549          CDS       T01166                                 

Gene name
porD
Definition
pyruvate ferredoxin oxidoreductase delta subunit PorD
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_0549 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0549 (porD)
   00020 Citrate cycle (TCA cycle)
    mru_0549 (porD)
   00620 Pyruvate metabolism
    mru_0549 (porD)
   00640 Propanoate metabolism
    mru_0549 (porD)
   00650 Butanoate metabolism
    mru_0549 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_0549 (porD)
   00680 Methane metabolism
    mru_0549 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    mru_0549 (porD)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     mru_0549 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739233..739475
Genome map
AA seq 80 aa AA seqDB search
MVSIGCAIYEPGSTRKNKTGSWRTFKPILDKDACVDCNNCLMFCPEGCVNKEHDIDYDYC
KGCGICKVECPVQAIKMEIE
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggtttctattggatgtgcaatttatgaacctggaagtacacgtaagaacaagacaggg
agttggagaacttttaagccaatccttgataaagacgcttgtgtagattgcaataactgt
ctcatgttctgtcctgaaggatgcgtaaacaaggagcatgacattgattacgattattgt
aaaggttgcggtatttgtaaagtagaatgcccagttcaagctattaaaatggaaatagaa
tag

DBGET integrated database retrieval system