KEGG   Methanobrevibacter ruminantium: mru_0550Help
Entry
mru_0550          CDS       T01166                                 

Gene name
porA
Definition
(RefSeq) pyruvate ferredoxin oxidoreductase alpha subunit PorA (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_0550 (porA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_0550 (porA)
   00020 Citrate cycle (TCA cycle)
    mru_0550 (porA)
   00620 Pyruvate metabolism
    mru_0550 (porA)
   00640 Propanoate metabolism
    mru_0550 (porA)
   00650 Butanoate metabolism
    mru_0550 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_0550 (porA)
   00680 Methane metabolism
    mru_0550 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    mru_0550 (porA)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     mru_0550 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739538..740686
Genome map
AA seq 382 aa AA seqDB search
MAKEIMTTNRAVAEAVKLAKPQVVPVYPITPQTTISEYLAQFVADGDLDAEYIRVESEHS
AISATLGASEAGVRVFTATSSQGLMLMHEILFAAAGMRAPIVMADANRAISAPLNIWNDQ
QDSIAQRDAGWIQLYVENAQEAFDTVLQAYRIAEHEEVMLPVMVCLDGFILTHTVEPVDL
LEQADVDTFLEPYVPKFAFLDPEKPMSLGNFADPEYYTEARHDMQVAMDKSMDVIKEVGA
EFGEKFGRTYGLTEPYLCDDAEIILVCMGSMASTVRYVVDNLREKGEKVGLLKIRAYRPF
PFEEIDEIVKNADKLAVLDKNFSFGIGGALFADLKAKCHKETYGFILGLGGRDVIPEYIE
EAVELTKNPVKEVTWLGLKEDE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaattatgacaacaaatagagcagttgcagaagctgtaaagttagcaaaa
ccacaagttgttcctgtttaccctattactcctcaaactacaatatccgaataccttgca
cagtttgttgcagacggcgatttggatgctgagtatattagagttgaatctgaacacagt
gcgattagtgctactttaggagcttccgaagcgggagtaagagtattcaccgctacttca
tctcaaggattaatgcttatgcatgagatattgtttgcagctgcaggtatgagagctcca
atagtaatggcagatgcaaacagggcaatttctgctccattaaacatttggaacgatcaa
caagactccatcgcacaaagggatgcaggatggatacagctttatgtggaaaatgctcaa
gaggcattcgacactgtgcttcaagcatatagaattgcagagcatgaagaggtcatgctt
ccagtaatggtatgtttagacggatttattttaacacacactgtcgagccagtagattta
ttggaacaagctgatgtggatacattcctcgaaccatacgtacctaagtttgcattttta
gaccctgaaaaaccaatgtcattaggtaactttgcagaccctgaatattatacagaagca
agacatgacatgcaagtggctatggacaagtccatggatgtaatcaaggaagtaggtgcg
gaattcggtgaaaaattcggaaggacctacggcttgactgaaccttacctttgtgacgat
gcagagatcatattggtctgtatgggttcaatggcaagtacagtaagatatgtggtagat
aatttaagagaaaaaggcgaaaaagtaggtctcttaaaaataagggcttacagaccattc
ccattcgaggaaattgacgaaattgtcaaaaatgctgataaattagctgtgcttgacaag
aacttctcatttggtattggaggagcgctttttgcagacttgaaagccaaatgccacaag
gaaacctatggtttcattttaggattaggtggaagagacgtaattcctgaatacattgaa
gaagctgtcgaattaactaaaaatccagtaaaagaagttacttggttaggcttaaaggag
gatgaataa

DBGET integrated database retrieval system