KEGG   Methanobrevibacter ruminantium: mru_1061Help
Entry
mru_1061          CDS       T01166                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase RfbC2 (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    mru_1061 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mru_1061 (rfbC2)
Enzymes [BR:mru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     mru_1061 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1384524..1385087)
Genome map
AA seq 187 aa AA seqDB search
MGKFKIVKSEIEGVFTVEPTVFEDERGYFMETYNENDFKAEGIDLTFVQDNQSKSSKGVL
RGLHFQYTQPQGKLVRVIKGEVFDVGVDLRKDSPTYGKWVGEILSEENKKQLFIPKGFAH
GFLVLSDEAEFVYKCTDFYKGDDEGGIQWNDPEIGIKWPLGNLKEEDIILSEKDKLWKPM
KETPTDF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtttaagattgttaaaagtgaaattgaaggtgtatttacagttgaacctacc
gtttttgaagatgaaaggggctactttatggaaacctacaatgagaatgactttaaggca
gaggggattgatttaacctttgttcaagacaatcaatcaaagtcatctaaaggtgtcctt
agaggtctccatttccaatacacacagccacaaggaaagctggttcgtgtaataaaagga
gaagtcttcgatgtgggagtggatcttagaaaagactcacccacatatggaaaatgggta
ggggaaatactctctgaagaaaacaaaaaacaactatttataccaaaaggatttgcccat
ggctttttagtattatcagatgaagcagaatttgtatacaaatgcacagacttctacaaa
ggagatgatgagggaggaatccaatggaacgatccagaaataggaataaaatggccattg
ggaaatcttaaggaagaagatataattttatctgaaaaggacaaattatggaagccgatg
aaagagactccaactgatttttga

DBGET integrated database retrieval system