KEGG   Methanobrevibacter ruminantium: mru_1119Help
Entry
mru_1119          CDS       T01166                                 

Gene name
pepA
Definition
glutamyl aminopeptidase PepA (EC:3.4.11.7)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mru00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467909..1469012
Genome map
AA seq 367 aa AA seqDB search
MKGEMMTSDEKIKLVEELCMTPGISGFEEKIAEIIKRELKDVADKIEVDKMGNLIATKKG
SSKKGPTVMLASHMDEIGLMVSYIDDNGYLKFATIGGINDQMLMNQTVVIHSKNGDVTGV
IGSKPPHVTKPEEKKKVVPYDEMFIDIGAKDKEQAEEMVSIGDPITFKTWFEAFPNNLVM
CKALDNRLGCYVMMEVLKRVDSKATVYGVGTTQEEVGLKGAKVTSYKLNPDMAFALDVTL
SGDHPGIKPEEAPVVIGKGPAVILIDASGRGIITPKYIRELLINTGEKEEIPYQLEVSSG
GTTDGTAIHLTKEGIPTGVLSVPTRYIHTTVSVASMDDVENTIQLIVAAINSLEINFKYI
FSILNTF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgaaatgatgacatctgatgaaaaaattaaattagtagaagaactctgtatg
actccaggtatctctgggtttgaagaaaagattgcagagattattaaaagagaattaaaa
gatgtagcagataaaattgaagtagacaagatgggaaatctaatcgctactaaaaaaggt
tcttctaaaaaaggaccaaccgtaatgttggcatcccatatggatgaaattggtttgatg
gtaagctatatcgacgataatggttaccttaagtttgcaaccattggcggaatcaacgat
caaatgcttatgaaccaaacagttgttatccattccaaaaatggtgatgtgactggagtt
atcggttctaagccacctcatgtaaccaagcctgaagagaaaaagaaagttgttccatat
gatgaaatgtttattgatattggagcaaaggataaggagcaagctgaagagatggtttcc
attggagatccaattacatttaaaacatggtttgaagcatttccaaataatttagtaatg
tgtaaggcattggataaccgtttaggctgttatgtcatgatggaagtcttaaaaagagtg
gattccaaagctacagtatatggtgttggaacaacccaagaggaagttggcttgaaaggt
gcaaaagtaacttcatataagttaaacccagatatggcatttgctcttgacgttacctta
tccggagatcaccctggaataaaacctgaagaggctcctgttgttataggaaaaggacct
gctgtaatcttaatcgatgcaagcggcagaggaataattactcctaaatacattagagag
cttttgattaacactggagaaaaagaagaaattccataccagcttgaagtaagtagtggt
ggtacaactgatggtacagcaattcaccttaccaaagaaggaattcctaccggtgtatta
tctgttccaaccaggtatattcacacaactgttagcgtagcaagtatggatgatgttgaa
aatacaattcaattgattgtagctgctataaacagtttagaaataaattttaaatacatt
ttcagtattttaaatactttttaa

DBGET integrated database retrieval system