KEGG   Methanobrevibacter ruminantium: mru_1119Help
Entry
mru_1119          CDS       T01166                                 

Gene name
pepA
Definition
glutamyl aminopeptidase PepA (EC:3.4.11.7)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    mru_1119 (pepA)
Enzymes [BR:mru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     mru_1119 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467909..1469012
Genome map
AA seq 367 aa AA seqDB search
MKGEMMTSDEKIKLVEELCMTPGISGFEEKIAEIIKRELKDVADKIEVDKMGNLIATKKG
SSKKGPTVMLASHMDEIGLMVSYIDDNGYLKFATIGGINDQMLMNQTVVIHSKNGDVTGV
IGSKPPHVTKPEEKKKVVPYDEMFIDIGAKDKEQAEEMVSIGDPITFKTWFEAFPNNLVM
CKALDNRLGCYVMMEVLKRVDSKATVYGVGTTQEEVGLKGAKVTSYKLNPDMAFALDVTL
SGDHPGIKPEEAPVVIGKGPAVILIDASGRGIITPKYIRELLINTGEKEEIPYQLEVSSG
GTTDGTAIHLTKEGIPTGVLSVPTRYIHTTVSVASMDDVENTIQLIVAAINSLEINFKYI
FSILNTF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgaaatgatgacatctgatgaaaaaattaaattagtagaagaactctgtatg
actccaggtatctctgggtttgaagaaaagattgcagagattattaaaagagaattaaaa
gatgtagcagataaaattgaagtagacaagatgggaaatctaatcgctactaaaaaaggt
tcttctaaaaaaggaccaaccgtaatgttggcatcccatatggatgaaattggtttgatg
gtaagctatatcgacgataatggttaccttaagtttgcaaccattggcggaatcaacgat
caaatgcttatgaaccaaacagttgttatccattccaaaaatggtgatgtgactggagtt
atcggttctaagccacctcatgtaaccaagcctgaagagaaaaagaaagttgttccatat
gatgaaatgtttattgatattggagcaaaggataaggagcaagctgaagagatggtttcc
attggagatccaattacatttaaaacatggtttgaagcatttccaaataatttagtaatg
tgtaaggcattggataaccgtttaggctgttatgtcatgatggaagtcttaaaaagagtg
gattccaaagctacagtatatggtgttggaacaacccaagaggaagttggcttgaaaggt
gcaaaagtaacttcatataagttaaacccagatatggcatttgctcttgacgttacctta
tccggagatcaccctggaataaaacctgaagaggctcctgttgttataggaaaaggacct
gctgtaatcttaatcgatgcaagcggcagaggaataattactcctaaatacattagagag
cttttgattaacactggagaaaaagaagaaattccataccagcttgaagtaagtagtggt
ggtacaactgatggtacagcaattcaccttaccaaagaaggaattcctaccggtgtatta
tctgttccaaccaggtatattcacacaactgttagcgtagcaagtatggatgatgttgaa
aatacaattcaattgattgtagctgctataaacagtttagaaataaattttaaatacatt
ttcagtattttaaatactttttaa

DBGET integrated database retrieval system