KEGG   Methanobrevibacter ruminantium: mru_1143Help
Entry
mru_1143          CDS       T01166                                 

Gene name
asnB
Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing) AsnB
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00250  Alanine, aspartate and glutamate metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    mru_1143 (asnB)
Enzymes [BR:mru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     mru_1143 (asnB)
Peptidases [BR:mru01002]
 Cysteine Peptidases
  Family C44
   mru_1143 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 BAR UPF0270
Motif
Other DBs
NCBI-ProteinID: ADC46993
UniProt: D3E382
Position
complement(1511746..1513557)
Genome map
AA seq 603 aa AA seqDB search
MCGCIGLVGNFNKELLFSMMESTKHRGMDSSGYYLYNKGSSESLYENNFILDNRKSFNES
SMEDNDSNQCSTIGLGHNLLSIFNLINEKREITDNINENRQPIILDNLVFIFNGEIYNFN
KLESFLKENNENYVKSKSDSQLLANLIQYYYKETNSGNQENPLLESVKEVVGQLDGDYAF
AIYDKDNDDLAISRDSIGVKPLFYAVTDNLKGFASERKALWKAGFEDSDIKDLKPGSILY
NFEEIDLDDDLINEIINTDFKLLKSSFDDYKSYLDTKDTYDVYKELLADDIYEAVEKRVE
NIVDIGLIFSGGVDSTILAVILKSIAEKRQKQIDSVNNKSSDLDNVFLNGLGETSNPSNN
SLENSKSSNDFSENVKPLNIRLYAVGLENSQDIEFSKRVAKDLDLDLKTIIIDEDTIRKS
VPDVLTAIEDPNIMKLGVGMTIYLATKAIHEDNIKVALSGQGADELFGGYNRYLKHFDNH
TLFDAYFDLDEEIYHDIANIYHVNLERDDAVAMANGVELRVPFLDKDVISLALDIPGKFK
IKDGDDLLRKHILRDLAKDIGVAEYIADRPKKAAQYGSGINKILKKKVLRSFNIEEFVES
LKH
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggctgtataggtctggtaggaaattttaataaagaattactattttctatgatg
gaatctactaaacataggggaatggattcaagcggatattatttatacaataagggttca
tctgaatcactctatgaaaataatttcattttagataatagaaaatctttcaatgaatca
tctatggaagataatgattccaatcaatgttctacaataggccttggacataatctattg
tccatatttaatctaatcaatgaaaaaagagaaataacagacaatatcaatgaaaacaga
cagccgatcatattggataatcttgtattcatattcaatggagagatatataatttcaat
aagcttgaaagctttctaaaggaaaacaatgaaaattatgtaaagtccaaaagtgacagt
caactattggctaatttgattcaatattattataaagagacaaattcaggcaatcaggaa
aatcctcttttagaatctgtaaaagaagtcgtaggtcaattggatggagactatgcgttt
gcaatatatgataaggataatgatgatttggccatatcaagagattccattggagtaaag
cctttattttatgctgtaactgataatctgaaaggatttgcatctgaaaggaaagcactt
tggaaggctggatttgaagatagtgacataaaggatttaaagccaggatccattctatac
aactttgaagaaattgatttagatgatgatttgataaatgaaatcataaatactgacttt
aaattgcttaaatcttcatttgatgactataaatcctatttggacactaaagatacctat
gatgtttataaagagctcttggctgatgatatatatgaggcagttgaaaagcgtgttgaa
aacatagtagatataggccttatattctctggaggagttgacagtactattttagcggtc
attctaaagagcattgcagaaaaaaggcaaaagcaaattgattcagttaataataaatct
tcagatttggataacgtgtttttaaatggtttgggggaaactagcaatccatcaaataat
tcactagaaaatagcaaatcatcaaatgacttttcagaaaatgttaagccattaaacata
aggctatatgcagtaggacttgaaaactcacaggatatcgaattcagcaaaagggttgcc
aaagatttagatttagacttaaagacaataattatagatgaagatacaatcagaaagagc
gttccagatgtgctgactgccatagaagacccaaacatcatgaagcttggcgttggaatg
accatataccttgcaactaaggcaatccatgaagataatataaaggtagctctatctgga
cagggtgcagatgagctctttggtggatataacagatatctgaaacattttgataatcac
actctatttgatgcatattttgacttggatgaagagatatatcatgacattgcaaacata
tatcacgtcaatcttgaaagggatgatgcagttgcaatggccaatggggtagaactaagg
gttccgtttttagataaggatgtaattagccttgcattggatattccagggaaattcaag
ataaaagatggtgatgaccttcttagaaagcatatattaagggacttggctaaggacatt
ggagtggctgaatatattgcagacagacctaagaaggctgctcaatacggctctggcata
aataagattctaaaaaagaaagttttgagaagctttaacattgaagagtttgtagaatcc
ttaaaacattag

DBGET integrated database retrieval system