KEGG   Methanobrevibacter ruminantium: mru_1392Help
Entry
mru_1392          CDS       T01166                                 

Gene name
ehaT
Definition
carbohydrate kinase PfkB family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    mru_1392 (ehaT)
Enzymes [BR:mru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     mru_1392 (ehaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1839841..1840869)
Genome map
AA seq 342 aa AA seqDB search
MDEKDLKSSNNVTAEDLGVDEIVYDAINVDVIGFGALNVDKLYRVGHIAEIDEESFIKGE
EQSPGGSAANTIIGLSKLGCSTSYIGKIADDEEGDLLEYNLMVNNVYLTNLIYADSGNSG
KVLGFVSDEGDRALYVDPGVNDDITIDEINPLNVNACKILHYTSFVGDSFNAQKELLNVL
GDDIVLSFDPGMLYVKKGVLELKEILERTNILLINENELKILFEDHYKEKLSVSKDLTFR
DLAVFIRDDGIDTVVVKRGENGVYAINKDDDEVKAPAFKCEAVDTTAAGDSFNAGFLYSY
LKGYDLAKSCLIANWVASRSVQAIGISGLPNLEELEEFISSL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaggatttaaaatcttcaaataatgtgactgctgaggatttaggcgttgat
gagatagtctatgatgcaatcaatgtagatgtcatcggctttggcgcattgaatgtggat
aagctttaccgtgttggccatattgcagagattgatgaagaaagcttcatcaaaggagaa
gagcaatctccaggtggttctgcagccaatacaataatcggcctatctaagcttggatgc
tccacatcttatatcggaaagatagcagatgatgaggaaggagacctattggaatataac
cttatggtcaataatgtctatctgacaaatcttatctatgccgatagtggcaattcaggc
aaagtacttggatttgtctcagatgagggagatagggcattatatgtcgaccctggagta
aacgatgacataactattgatgagattaatccattgaatgtaaatgcctgcaagatactt
cattacacctcctttgtaggggattcctttaatgctcaaaaggaattgctcaatgtctta
ggtgatgatattgtattaagctttgatcctggaatgctatatgttaaaaagggagtctta
gaacttaaggaaattcttgaaagaactaatattcttctcattaatgaaaatgaactgaaa
atcctctttgaagatcattataaggaaaaattatctgtctctaaggatttgacctttagg
gacttggcagttttcatccgtgatgatggcattgatacagttgttgtaaaaaggggagaa
aatggagtctatgcaataaataaagatgatgatgaggttaaggcacctgcattcaagtgt
gaggcagttgatacaactgctgctggagattcctttaatgcaggcttcctgtattcatat
cttaagggctatgatttggctaaatcatgtctgattgctaattgggtggcttctaggtct
gttcaggcaattggaatatctggattgcctaatctggaagagctggaagagttcatatct
tccttatga

DBGET integrated database retrieval system