KEGG   Methanobrevibacter ruminantium: mru_1434Help
Entry
mru_1434          CDS       T01166                                 

Gene name
acsA
Definition
(RefSeq) acetyl-CoA synthetase AcsA (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_1434 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_1434 (acsA)
   00620 Pyruvate metabolism
    mru_1434 (acsA)
   00640 Propanoate metabolism
    mru_1434 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_1434 (acsA)
   00680 Methane metabolism
    mru_1434 (acsA)
Enzymes [BR:mru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     mru_1434 (acsA)
Lipid biosynthesis proteins [BR:mru01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   mru_1434 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880217..1881881)
Genome map
AA seq 554 aa AA seqDB search
MTSLIGNFVNRVDFKSYKDFYDNFEFNVPKDFNFGFDVVDEYARIDPDKKALIWCDDYEK
RVFTFLDMKKLSNQTANFFKSQGINKGDAVLLTLKNRYEFWICMVALHKIGAIAIPTTHM
VKLHDIVYRVESASIKMVVTVEEDQLLPDFEQCEKELDIELKKVLVNSFRDGWFNFDNEI
AKMSEEFERPTGDEATHEDETFLIYFSSGTTGNPKMVAHAHTYAIGHLITAKYWHNVVED
GVHHTSADTGWGKAVWGNLYGQWIAGAAIFIYDYVRFNGLDLMEKIIENKVNTFCAPPTI
YRFLIKEDLSQFDFSDIQYATTAGEPLPPEVFKRFKEFTGLEIKEGFGQTETTLSLATFI
WMESKTGCVGKPSPAFKIGLLDEEGNPVDIGSEGEISFDVSGGRPVGLFKEYYRNQEKTD
EAWYNGYYHCGDTAYVDEDGYYTFVGRNDDIIKSSGYRIGPYEVENAVISRPSVLECAIT
GVDDELRGQIVKATIVLAKGYKPSEELKKEIQDHVKHETAPYKYPRMVEFVEELPKTISG
KIQRKIIRTRKSIY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgacatctttaataggaaactttgtaaacagagttgattttaaatcctataaggatttt
tacgataattttgaatttaatgtaccaaaggacttcaactttggttttgatgtagtggat
gagtatgcaagaatagatccggataaaaaagcattaatctggtgtgacgattatgaaaaa
agggtttttacctttttagatatgaagaaattatccaatcagactgcaaacttctttaag
tctcaaggaatcaataagggagatgcagtgcttcttacacttaaaaacagatatgaattc
tggatctgtatggttgcacttcataagataggtgctatagctatcccaactactcatatg
gtaaagcttcatgatatagtctaccgtgttgaaagcgcaagcataaagatggtggttaca
gttgaagaggaccaattgcttcctgattttgagcagtgcgaaaaagaattggacatagag
cttaagaaagtcttagtgaatagctttagggatggctggtttaattttgataatgaaatc
gctaaaatgagcgaggagtttgaaaggccaactggagatgaggcaacccatgaggatgag
acattccttatctatttctcaagcggaaccactggaaaccctaaaatggttgcacatgct
catacctatgcaatcggacacctcataactgcaaaatactggcataatgtcgttgaagac
ggtgtccaccatacctctgccgatacaggttggggaaaggctgtttggggtaacctttat
ggacaatggattgcaggcgctgcaatatttatctatgactatgtaaggttcaatggtttg
gatttaatggaaaagatcattgaaaacaaggtaaataccttctgtgcacctccgacaatc
tataggttcctcattaaggaggacttgtcccaatttgacttttcagacattcaatatgca
actaccgctggagagccattgcctccagaggtatttaaaagatttaaagagttcactggc
cttgaaatcaaggaaggattcggtcagacagagaccactctctcccttgcaaccttcatt
tggatggaatccaaaacaggttgtgtaggcaagccttcaccggcattcaagataggcctt
ttagatgaggaaggaaatcctgtggatattggttctgaaggagaaatatcatttgatgta
tctggaggaagacctgtaggtctgtttaaggagtattatagaaaccaagaaaagaccgat
gaagcttggtacaatggatattaccactgtggagacactgcatatgtggatgaagacgga
tattacacctttgttggtagaaatgatgacattatcaagtcttcaggttatcgtatcgga
ccatatgaagtggaaaatgcagtaatttcccgcccttcagtcttggaatgcgccataacc
ggtgttgatgatgaattaagaggccagattgttaaggcaacaatcgttcttgcaaaagga
tacaagccaagtgaagagcttaaaaaagaaatccaagatcatgtaaagcatgagaccgct
ccttataaatatccaagaatggtagaatttgtcgaagagcttcctaaaaccataagcggt
aaaattcaaagaaaaataatcagaactaggaaatcaatttattaa

DBGET integrated database retrieval system