KEGG   Methanobrevibacter ruminantium: mru_1461Help
Entry
mru_1461          CDS       T01166                                 

Gene name
galU
Definition
UDP-glucose pyrophosphorylase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mru_1461 (galU)
   00052 Galactose metabolism
    mru_1461 (galU)
   00500 Starch and sucrose metabolism
    mru_1461 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    mru_1461 (galU)
Enzymes [BR:mru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     mru_1461 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1912123..1912968)
Genome map
AA seq 281 aa AA seqDB search
MKAVIPAAGLGTRFLPATKAQPKEMLPVYDKPTIQYVIEESVNSGVDDILIVTGKGKRSI
EDHFDRSFELEHHLKTKGKEDFLKEIEYISDLADIHFIRQKKQKGLGDAIYCAKKHVGND
PFVVMLGDTITKDTVPCTKQLIDIYEKYEKSVIALEEVPDEKVERYGIIGGEEIEDSIYK
IDKLVEKPPLRVAPSNLAIMGRYVLTPDIFDCIENVEPGYGGEIQLTDALSKLDEIYGQV
FKGESYDIGNRIDWLKTSLRFALEDDSARDDILEFIKEEII
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcattcctgcagcagggcttggaacaagattccttcctgctactaaagct
caaccaaaagagatgttgccggtttatgacaagccgaccattcaatatgtaatagaagag
tctgtaaattccggtgtagatgatattctaatcgtaactggtaagggtaaaagatcaatt
gaagaccattttgacaggtccttcgaattggaacaccatttgaaaaccaaaggaaaagaa
gatttcctaaaggaaattgaatatatttcagatttggcagatattcattttataagacag
aaaaagcaaaaaggtcttggagatgctatatattgtgctaaaaagcatgtcggcaatgat
ccttttgttgtcatgttaggggataccattacaaaggatacagttccgtgcacaaagcaa
ttgattgacatctatgaaaagtatgaaaaatctgttatcgcccttgaagaggttccggat
gaaaaggttgaaagatatggtataataggcggtgaagagatagaggattcaatctataag
attgataagttagtggaaaagccacctcttagagtagcaccaagtaatttggctattatg
ggaagatatgtccttacacctgacatttttgattgcattgaaaatgtggagcctggatac
ggtggagaaatccaattgactgatgccttaagcaagcttgatgagatttatggccaggta
tttaagggagagtcatatgatattggaaaccgtattgattggctaaagacttccttaagg
tttgcattggaagatgacagtgcaagagatgatatattggaattcattaaagaagagatt
atttaa

DBGET integrated database retrieval system