KEGG   Methanobrevibacter ruminantium: mru_1492Help
Entry
mru_1492          CDS       T01166                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
mru00260  Glycine, serine and threonine metabolism
mru00750  Vitamin B6 metabolism
mru01100  Metabolic pathways
mru01110  Biosynthesis of secondary metabolites
mru01120  Microbial metabolism in diverse environments
mru01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_1492 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mru_1492 (thrC)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     mru_1492 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 zf-ribbon_3 HypA ACP_syn_III_C C1_2
Motif
Other DBs
NCBI-ProteinID: ADC47342
UniProt: D3E481
Position
complement(1944125..1945321)
Genome map
AA seq 398 aa AA seqDB search
MIRCVSCGEEYEDDEVIYNCKKCGSVLEVEMEVDVPKSTFEGRRDNLWKYKECLPVDADK
RVSLDEGGTPFCRCEKLGKELGIDLYVKVEGSNPTGSFKDRGMTIGMTKAMMLGVDTVGC
ASTGNTSASLAAYAARAGLRCAVFLPAGKVALGKLAQAMFHGAEVFSINGNFDEALEAMT
QLAREKYLYLLNSINPFRLEGQKTIGYEIVHDLGWESPDRIVLPVGNAGNISAIWKGITE
FHNAGFMDDVPMMTGIQAEGACPIANAYRDNTMDMVPVENPETIATAIRIGAPVSAVKAL
RAIYDSNGMAETVTDEEILAAQKLLARTEGVGVEPASAASIAGLKKLVEQGDVDKGERVV
CVVTGHLLKDPNTAIDACVDPVQVDADIDKIKEILLNK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattagatgtgtgtcttgtggagaagaatacgaagatgatgaagttatctacaactgt
aaaaaatgcgggtctgttttagaagtggaaatggaagtcgatgttcctaaatccaccttt
gaaggcagaagagataacttatggaaatataaagaatgcttgcctgttgatgcagataaa
agggtttccttagatgaaggaggaactccattctgcagatgtgaaaaattaggcaaggaa
cttggcattgacttatatgttaaagtggaaggatccaaccctaccggcagttttaaggac
agaggaatgactatcggtatgactaaagcaatgatgcttggtgtggatactgtaggttgc
gcttccactggaaacacctcagcttcccttgctgcttatgctgcaagagcgggacttaga
tgtgctgtatttttacctgcaggtaaagtggctcttggtaaattggcacaggctatgttc
cacggtgcagaagtgttctctatcaatggaaactttgatgaggctttggaagctatgact
cagcttgcccgtgaaaaatacttatacttactcaattcaatcaacccattcagattagaa
ggtcaaaagaccatcggttatgaaatcgtacatgatttaggttgggaatctcctgatagg
attgtattgcctgttggaaatgcaggaaacatttcagctatctggaaaggaataaccgaa
ttccataatgcaggattcatggatgacgttccaatgatgactggtattcaagctgaagga
gcttgtcctattgctaacgcttatagggataatactatggatatggttcctgttgaaaac
cctgaaaccattgcaactgctatccgtattggagctcctgtaagtgctgttaaggcttta
agagcaatctatgattccaatggtatggctgaaaccgtaactgatgaagaaatcttggct
gcacagaaattgcttgcaaggactgaaggcgtaggtgtggaacctgcttctgctgcttcc
attgcaggtcttaaaaagctagttgaacaaggagatgtcgataagggagaaagagttgta
tgtgtcgtaaccggacacttgcttaaagaccctaacactgcaatcgatgcatgtgttgat
cctgttcaagtggatgcagacattgataagattaaggagattttgcttaataaatag

DBGET integrated database retrieval system