KEGG   Methanobrevibacter ruminantium: mru_1492Help
Entry
mru_1492          CDS       T01166                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase ThrC (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mru_1492 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_1492 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    mru_1492 (thrC)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     mru_1492 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1944125..1945321)
Genome map
AA seq 398 aa AA seqDB search
MIRCVSCGEEYEDDEVIYNCKKCGSVLEVEMEVDVPKSTFEGRRDNLWKYKECLPVDADK
RVSLDEGGTPFCRCEKLGKELGIDLYVKVEGSNPTGSFKDRGMTIGMTKAMMLGVDTVGC
ASTGNTSASLAAYAARAGLRCAVFLPAGKVALGKLAQAMFHGAEVFSINGNFDEALEAMT
QLAREKYLYLLNSINPFRLEGQKTIGYEIVHDLGWESPDRIVLPVGNAGNISAIWKGITE
FHNAGFMDDVPMMTGIQAEGACPIANAYRDNTMDMVPVENPETIATAIRIGAPVSAVKAL
RAIYDSNGMAETVTDEEILAAQKLLARTEGVGVEPASAASIAGLKKLVEQGDVDKGERVV
CVVTGHLLKDPNTAIDACVDPVQVDADIDKIKEILLNK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattagatgtgtgtcttgtggagaagaatacgaagatgatgaagttatctacaactgt
aaaaaatgcgggtctgttttagaagtggaaatggaagtcgatgttcctaaatccaccttt
gaaggcagaagagataacttatggaaatataaagaatgcttgcctgttgatgcagataaa
agggtttccttagatgaaggaggaactccattctgcagatgtgaaaaattaggcaaggaa
cttggcattgacttatatgttaaagtggaaggatccaaccctaccggcagttttaaggac
agaggaatgactatcggtatgactaaagcaatgatgcttggtgtggatactgtaggttgc
gcttccactggaaacacctcagcttcccttgctgcttatgctgcaagagcgggacttaga
tgtgctgtatttttacctgcaggtaaagtggctcttggtaaattggcacaggctatgttc
cacggtgcagaagtgttctctatcaatggaaactttgatgaggctttggaagctatgact
cagcttgcccgtgaaaaatacttatacttactcaattcaatcaacccattcagattagaa
ggtcaaaagaccatcggttatgaaatcgtacatgatttaggttgggaatctcctgatagg
attgtattgcctgttggaaatgcaggaaacatttcagctatctggaaaggaataaccgaa
ttccataatgcaggattcatggatgacgttccaatgatgactggtattcaagctgaagga
gcttgtcctattgctaacgcttatagggataatactatggatatggttcctgttgaaaac
cctgaaaccattgcaactgctatccgtattggagctcctgtaagtgctgttaaggcttta
agagcaatctatgattccaatggtatggctgaaaccgtaactgatgaagaaatcttggct
gcacagaaattgcttgcaaggactgaaggcgtaggtgtggaacctgcttctgctgcttcc
attgcaggtcttaaaaagctagttgaacaaggagatgtcgataagggagaaagagttgta
tgtgtcgtaaccggacacttgcttaaagaccctaacactgcaatcgatgcatgtgttgat
cctgttcaagtggatgcagacattgataagattaaggagattttgcttaataaatag

DBGET integrated database retrieval system