KEGG   Methanobrevibacter ruminantium: mru_1492Help
Entry
mru_1492          CDS       T01166                                 

Gene name
thrC
Definition
threonine synthase ThrC (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mru01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mru00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mru00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1944125..1945321)
Genome map
AA seq 398 aa AA seqDB search
MIRCVSCGEEYEDDEVIYNCKKCGSVLEVEMEVDVPKSTFEGRRDNLWKYKECLPVDADK
RVSLDEGGTPFCRCEKLGKELGIDLYVKVEGSNPTGSFKDRGMTIGMTKAMMLGVDTVGC
ASTGNTSASLAAYAARAGLRCAVFLPAGKVALGKLAQAMFHGAEVFSINGNFDEALEAMT
QLAREKYLYLLNSINPFRLEGQKTIGYEIVHDLGWESPDRIVLPVGNAGNISAIWKGITE
FHNAGFMDDVPMMTGIQAEGACPIANAYRDNTMDMVPVENPETIATAIRIGAPVSAVKAL
RAIYDSNGMAETVTDEEILAAQKLLARTEGVGVEPASAASIAGLKKLVEQGDVDKGERVV
CVVTGHLLKDPNTAIDACVDPVQVDADIDKIKEILLNK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgattagatgtgtgtcttgtggagaagaatacgaagatgatgaagttatctacaactgt
aaaaaatgcgggtctgttttagaagtggaaatggaagtcgatgttcctaaatccaccttt
gaaggcagaagagataacttatggaaatataaagaatgcttgcctgttgatgcagataaa
agggtttccttagatgaaggaggaactccattctgcagatgtgaaaaattaggcaaggaa
cttggcattgacttatatgttaaagtggaaggatccaaccctaccggcagttttaaggac
agaggaatgactatcggtatgactaaagcaatgatgcttggtgtggatactgtaggttgc
gcttccactggaaacacctcagcttcccttgctgcttatgctgcaagagcgggacttaga
tgtgctgtatttttacctgcaggtaaagtggctcttggtaaattggcacaggctatgttc
cacggtgcagaagtgttctctatcaatggaaactttgatgaggctttggaagctatgact
cagcttgcccgtgaaaaatacttatacttactcaattcaatcaacccattcagattagaa
ggtcaaaagaccatcggttatgaaatcgtacatgatttaggttgggaatctcctgatagg
attgtattgcctgttggaaatgcaggaaacatttcagctatctggaaaggaataaccgaa
ttccataatgcaggattcatggatgacgttccaatgatgactggtattcaagctgaagga
gcttgtcctattgctaacgcttatagggataatactatggatatggttcctgttgaaaac
cctgaaaccattgcaactgctatccgtattggagctcctgtaagtgctgttaaggcttta
agagcaatctatgattccaatggtatggctgaaaccgtaactgatgaagaaatcttggct
gcacagaaattgcttgcaaggactgaaggcgtaggtgtggaacctgcttctgctgcttcc
attgcaggtcttaaaaagctagttgaacaaggagatgtcgataagggagaaagagttgta
tgtgtcgtaaccggacacttgcttaaagaccctaacactgcaatcgatgcatgtgttgat
cctgttcaagtggatgcagacattgataagattaaggagattttgcttaataaatag

DBGET integrated database retrieval system