KEGG   Methanobrevibacter ruminantium: mru_1544Help
Entry
mru_1544          CDS       T01166                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase HemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mru00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2007320..2008096
Genome map
AA seq 258 aa AA seqDB search
MKKKIAITRPQERSKAAKEFIENYGSEAIIVPTLELKLENTESLKNLMEKSNELDWLIFT
SVSSIESIFEFYPDFLDKLNPECKIATIGTKTAELGIKKGLPIDIIPKDYTAEGLLEEFE
RIDLNNKNVGVPRTFSARTILPEGLKNMGANVILAESYKSVIPEDTSKIEKLIQCILDEK
IDGITFTSPLTVSNLFEIAKDEDKDNLVEKLSTTTLTVAIGPITGNILNQLGVNHIYPKR
YTVKDMIDLMFRELNNRE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaatagcaatcacaagacctcaagaacggtcaaaagccgcaaaggagttt
atagaaaactatggatccgaagcaatcatagtcccaacacttgaattgaaactggaaaat
accgaatcactaaagaacctgatggaaaaatccaatgagctagactggttgatatttaca
tcagtaagttcaatcgaatcaatctttgaattctatccggacttcttggacaagttgaat
ccagagtgtaaaattgcaaccataggtactaaaactgcagaacttggtataaaaaaagga
ctccctatagacatcatacctaaagattatactgctgaaggactgcttgaagaatttgaa
agaatcgacttaaataataaaaatgttggcgtccctaggacattttctgcaaggactatt
ttacctgaaggacttaaaaatatgggggcaaatgtgatcttggctgaaagttataaatca
gtcattccagaggacacaagcaagatagaaaaactgattcaatgcatcttagatgaaaag
attgacggaatcacatttacaagtcctttaactgtatcaaacctttttgaaatagctaaa
gatgaagataaggataatctagttgaaaagttatctacaacaacccttactgtagctatt
ggaccaattacaggtaatatattgaaccaattaggagtaaatcacatctatccaaaaagg
tatactgtaaaagacatgattgacttgatgtttagggagttaaacaatagggaataa

DBGET integrated database retrieval system