KEGG   Methanobrevibacter ruminantium: mru_1684Help
Entry
mru_1684          CDS       T01166                                 

Definition
histone acetyltransferase ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mru  Methanobrevibacter ruminantium
Brite
Enzymes [BR:mru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     mru_1684
Transfer RNA biogenesis [BR:mru03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    mru_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182866..2184572
Genome map
AA seq 568 aa AA seqDB search
MDKACRIIIEDIMNGKITTRRELEVEKRQLCRDRKLKKFMSNSVILEHASLEEKKIVSNL
LRKKPTRTISGVAIVAVMCHPHQCPHGRCFYCPESDIAPPSYTGEEPAALRGRMFKFHPY
VQCYNRLKQLHKVGHPIDKVELIIMGGTFPSKDICYQEWFVSQCLKAMCDFGIILENISQ
IDDIESIKREGLLKYHPYSNNELKTYPPNDYVLIDDIQRINENSKVRCIGMTFETRPDYC
KEPHVDRMLDMGVTRVELGVQTIYNHIYEKIKRGHKVEDVIEANRILRDSGVKVAMHMMP
GLFPLARENPRIEQCPEQDLKMFKEIFNNENFKPDMLKIYPCLVTEGSELHKLYKEGKYR
PYTDEEAVELIVQIKKILPKWVRTMRIQRDIPSTLIEAGVKKSNLGELVYNRLEEEKINC
QCIRCREIGHKKTEQDYSIDDYRLFQEDYTAVGGKEHFLSIEDKNEESLAGFLRLRMPTE
QAHREEIRDNTAIVRELHVYGNMIKIGHKGNAIGQHTGFGERLLKKAEEISIDQNKEELL
IISGIGARNYYRKFGYERKGPYMAKKLI
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggataaagcatgcagaatcatcatagaagacattatgaatggaaaaataactactcga
cgtgaattggaagtagaaaaaagacagctatgcagagatagaaaattaaaaaagttcatg
agcaattcagttatcctagagcatgcaagccttgaagagaaaaagatcgtatcaaaccta
ttaaggaaaaagccaactagaactatctctggagtggctatagtggctgtcatgtgccat
ccacaccaatgtcctcatggaagatgtttctattgccctgaaagtgatattgcacctcca
agttataccggagaagagcctgctgcattaaggggcagaatgttcaagttccacccttat
gtacaatgctataaccgattaaagcaacttcataaggtaggccatcctatcgacaaggtg
gaacttatcatcatgggaggaacattcccttcaaaggatatctgctatcaggaatggttc
gtttcacaatgtctaaaggctatgtgcgattttggaattatccttgaaaacatcagccaa
atcgatgatatcgaatcaataaagagagaaggccttttaaaataccatccttattcaaac
aatgaattgaagacttatccccctaacgactatgtcctaatagatgacattcaaaggata
aatgaaaattcaaaggtcagatgcattggaatgacctttgagactcgtccagactactgt
aaagagccccatgtagatagaatgcttgacatgggagttacaagagtagaattaggagtt
cagacaatctataatcacatctacgaaaagataaaaagaggccataaggtagaggatgtg
attgaggcaaacagaatcctaagggattccggagtaaaggtagccatgcatatgatgcca
gggctatttccacttgcaagggagaatccaagaatagaacaatgtccagaacaggaccta
aagatgtttaaggaaatcttcaacaatgaaaactttaagccagatatgcttaaaatctat
ccttgccttgtaactgaaggaagcgaacttcacaagctttataaggaaggcaaatacagg
ccttacactgatgaagaggctgtagaattgatagttcaaatcaagaagatccttcccaaa
tgggttagaaccatgagaatccaaagggacattccatctaccttgattgaagcaggagtc
aagaaatcaaaccttggcgaattggtctataaccgacttgaagaggaaaaaataaactgc
caatgcataagatgcagggaaataggccataagaaaacagaacaggactattcaattgat
gattacagattattccaagaagattacactgcagtgggaggtaaggaacacttcctatcc
atagaagataagaatgaggaaagcttagcaggattcttaaggcttagaatgcctacagaa
caagcccatagagaagagattagagacaatactgcaatagtaagagaactccatgtctat
gggaacatgattaagataggccataagggaaacgccataggtcagcataccggatttgga
gaaagacttcttaagaaagctgaagagataagcatcgaccaaaacaaggaagagctttta
ataatcagtggtatcggagcacgaaactattatcgtaagtttggttatgaacgtaaaggt
ccttatatggctaaaaaactaatctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system