KEGG   Methanobrevibacter ruminantium: mru_1741Help
Entry
mru_1741          CDS       T01166                                 

Definition
arginase/agmatinase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    mru_1741
Enzymes [BR:mru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     mru_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2251637..2252611)
Genome map
AA seq 324 aa AA seqDB search
MLFNTYEPGKFAFSHESVDYYDLINSEDNLNGSSDFSKSKKWGIIGVPFDSTCSYHHGSR
YAPTIIREASFGLEQYNSEFDKLLDGEFYDCGDLNVVHGNCKRTCEILEDSVNDLIEANI
KPIIIGGEHSVTLGSVNALSALEDKNNLNDITVIHLDAHRDIIDEYIGEKYSHATIMKRI
YDLEPKELIQIGIRSFSEEERDFVEDKENIISFYAKDIKNQNIHLNEDVSTFEDLLSKLD
SIEGKVYISIDMDVFDPSVAPSVGNPTPNGLFLADVQAIFEALSFNEEIDIIGFDLVELA
SDRLGDISGVLAAKVIYDFLTLFA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttttcaatacttatgaaccgggcaaatttgctttttcacatgaatctgttgattat
tatgatttaattaactcagaagataatttaaatggttcttctgatttttcaaagtcaaaa
aaatggggaataatcggagttccttttgacagcacctgttcttatcaccatgggtcccgt
tatgctcctacaatcataagagaagcctcttttggccttgaacaatacaacagcgaattc
gataagcttttagatggcgaattttatgactgcggtgacttgaatgttgttcatggaaac
tgcaaaaggacttgtgaaatcctggaagattctgtaaatgacttgattgaagcaaacatc
aagcctatcattatagggggagagcatagtgtcactttaggttcagttaatgcattatct
gctttagaagataaaaacaatttaaatgacatcactgtcattcatttggatgctcataga
gacatcattgatgaatatatcggtgaaaagtattcacatgccaccattatgaaaagaatc
tatgatttggagcctaaggaactgattcaaataggaataagatcattctctgaggaagaa
agggattttgtagaggataaggaaaatataatcagtttttatgcaaaggacattaagaat
cagaatattcatctaaacgaagacgtttccacatttgaagacttattgtctaaattggat
tcaatcgaaggtaaagtctacatttcaattgatatggatgtatttgacccttcagttgct
ccatctgttggaaatccaactcctaatggtctgtttttagctgatgttcaagctatcttt
gaagcactaagctttaatgaagagatagatattattggatttgacttggtagagcttgca
agcgacagattgggagatattagtggagtccttgcagctaaagttatttatgactttttg
actctctttgcttga

DBGET integrated database retrieval system