KEGG   Methanobrevibacter ruminantium: mru_1822Help
Entry
mru_1822          CDS       T01166                                 

Gene name
tpiA
Definition
triosephosphate isomerase TpiA (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_1822 (tpiA)
   01230 Biosynthesis of amino acids
    mru_1822 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_1822 (tpiA)
   00051 Fructose and mannose metabolism
    mru_1822 (tpiA)
   00562 Inositol phosphate metabolism
    mru_1822 (tpiA)
Enzymes [BR:mru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     mru_1822 (tpiA)
Exosome [BR:mru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   mru_1822 (tpiA)
  Exosomal proteins of bladder cancer cells
   mru_1822 (tpiA)
  Exosomal proteins of melanoma cells
   mru_1822 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2354730..2355404)
Genome map
AA seq 224 aa AA seqDB search
MSLKTPVVILNFKTYLESSGQKALDLANALESAGEESGITMVAVPQAIDIYRIKEETSIP
VLAQHIDAVSPGGHTGSNLFESFVANGVDGTLLNHSECRMTLADIAEVVQKTKGADLISC
VCTNNIETSMAAATLAPDFVAVEPPELIGTGIPVSKADPEVVEGSVSKVKAINKDVQVLC
GAGISTGEDMAAAIDLGAEGVLLASGIIKAENPKDALLDLVSKI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcttaagacacctgttgttatattaaattttaaaacttatttggaatccagcggt
caaaaggcattggatttggcaaatgctttagaaagcgctggagaagaatctggaattact
atggttgctgtaccacaggccattgatatctataggattaaagaggaaacaagcattcct
gttttagctcaacatattgatgcagtttcccctggaggccatactggaagcaacttattc
gaaagctttgtggcaaatggtgttgacggaaccttattgaatcactctgaatgcagaatg
actcttgcagatattgcagaggtcgttcaaaaaacaaagggagctgatttaatctcatgt
gtttgcacaaacaatattgaaacaagtatggcagctgcaactcttgctccagattttgtt
gctgtagagccacctgaacttattggaactggaatacctgtttctaaggcagaccctgaa
gttgtagaaggaagcgtatctaaagtaaaggctattaataaggatgttcaggtcttatgc
ggtgctggaatctccactggtgaggatatggctgcagctattgatttaggtgctgaaggt
gtgctattggcttctggaattataaaagcggaaaatcctaaagatgccttattggatttg
gtaagtaagatttag

DBGET integrated database retrieval system