KEGG   Methanobrevibacter ruminantium: mru_1824Help
Entry
mru_1824          CDS       T01166                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta subunit SucC (EC:6.2.1.-)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mru_1824 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    mru_1824 (sucC)
   00640 Propanoate metabolism
    mru_1824 (sucC)
   00660 C5-Branched dibasic acid metabolism
    mru_1824 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    mru_1824 (sucC)
Enzymes [BR:mru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     mru_1824 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2356632..2357756)
Genome map
AA seq 374 aa AA seqDB search
MKFFEHSAKKVFESEGIKILEGHVVYSPEEAMEVATEFGRPIVLKSQVLVGGRGKAGGIK
FADNPGEALEIANELLKLEIKGEKVKHLLIEEKANIKKEFFLSVSNDRANRRPIIMASAE
GGVEIEELAKTSPEKIIRYNVNPLKEFLPYEAREIARKMGVGSELISPLGSIIWKLYNVY
DKYDAEVAEINPLILTDDGLIAADAKLEIENDALFRHQDLVKQNRFKQKDFAFVKLDGDI
AVIGNGAGLTLTGMDMVTLFGGKPATFLDIGGGASEETINKALSLVLNYPPVKVVFLNVL
GGITRADDVARGVIAALEANKWDVNIVIRLTGTNEEEGQRLFDEAGIPYEISLEEAAKKA
VEMCNEIKAKEAGK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttgaacatagcgcaaaaaaagtatttgaaagtgaaggtattaaaatttta
gaggggcatgtggtatactcccctgaagaggcaatggaagtggctaccgaattcggcagg
cctatcgtattgaaatcccaagtcttggtcggtggaagaggcaaggctggaggtattaag
tttgctgataaccctggtgaagctcttgaaattgctaatgaattattgaaacttgaaata
aaaggggaaaaggttaaacacttgctcattgaagagaaggcaaatatcaaaaaggaattc
ttcttaagcgtttccaatgacagagccaacagaaggcctatcatcatggcaagtgctgaa
ggtggagttgaaattgaagaattggcaaagacatcacctgaaaagatcatcagatataat
gtaaatcctttaaaggagttcttgccttatgaggcacgtgaaatagcccgaaagatgggt
gtaggctctgaattgatttctcctcttggaagcatcatttggaagctttataatgtttat
gataaatatgatgcagaagtggctgaaatcaaccctctcattttaactgacgacggcttg
attgctgcagatgcaaagcttgaaatagagaatgacgctcttttccgtcatcaggattta
gtaaagcaaaacagattcaagcaaaaggactttgcttttgtaaagcttgatggagacatt
gctgttatcggaaacggtgcagggctcactttaaccggtatggatatggttaccttattc
ggaggaaagccagcaactttcttggatatcggtggtggagcatctgaagagactatcaat
aaggctttaagtttggttttaaactatcctcctgtaaaagtagtgttcttaaatgtttta
ggaggtattactagagcagatgatgttgcaagaggcgtaattgcagcattggaagctaat
aagtgggatgtaaatattgtaatcagacttactggtactaatgaagaggaaggtcaaaga
ctctttgatgaggcaggcattccttatgagatctcattggaagaagctgctaaaaaggca
gttgaaatgtgcaatgagataaaagcaaaagaagctggcaaatag

DBGET integrated database retrieval system