KEGG   Methanobrevibacter ruminantium: mru_1842Help
Entry
mru_1842          CDS       T01166                                 

Gene name
cofE
Definition
F420-0:gamma-glutamyl ligase CofE
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mru00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373712..2374476
Genome map
AA seq 254 aa AA seqDB search
MTLELFGLKKIPLVKKGDDIAKIIEDDLKEEDIQLENGDILLIAETLISKAEGNIIKMDD
VEVSDKAIEIAEKCKKDPKIVETILQESNEIVAVGPNFIVTETKHGFVCANSGIDESNVE
DGLATPMPENPDKSAKEIREYLEEKYQKEIAIIITDTQGRAFRVGAIGTAIGCSGINPLW
VRIGDTDLYGRALETTEVATADELAAAASLLMGQADEGIPIVLIRGFDAFNILRDTETGI
KPLLRPKEFDVFRK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactttagaattatttggattaaaaaaaattcctttggtaaaaaaaggagatgacatt
gcaaagattatagaagatgacttgaaagaggaagatatccaacttgaaaatggagacatc
ttgctcatagctgaaacattaatttcaaaggctgaaggaaacatcataaagatggatgat
gttgaagtaagcgacaaagccatagaaatagctgaaaagtgcaaaaaagaccctaagatt
gtcgaaaccatccttcaggaatccaatgaaatcgttgcagtaggccctaatttcatagtt
acagaaaccaagcacggatttgtatgcgccaactctggaatagacgaatccaatgtagag
gacggattggctaccccaatgcctgaaaaccctgacaagtctgctaaggaaatcagagaa
tacttagaagaaaaatatcaaaaggagatagcaatcataatcacagacacccaaggaagg
gcatttagagtgggagcaatcggaactgcaatcggatgctctggaatcaaccccctttgg
gtgagaataggagatacagatctttatggaagggctcttgaaaccacagaagtggctaca
gctgatgagcttgcagctgctgcatccttattaatgggacaagcagatgaaggaattcct
atagttcttataagaggattcgatgcatttaatatccttagagatactgaaactggaatc
aagccactccttagaccaaaagagtttgatgtgtttagaaaataa

DBGET integrated database retrieval system