KEGG   Methanobrevibacter ruminantium: mru_1842Help
Entry
mru_1842          CDS       T01166                                 

Gene name
cofE
Definition
F420-0:gamma-glutamyl ligase CofE
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    mru_1842 (cofE)
Enzymes [BR:mru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     mru_1842 (cofE)
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     mru_1842 (cofE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373712..2374476
Genome map
AA seq 254 aa AA seqDB search
MTLELFGLKKIPLVKKGDDIAKIIEDDLKEEDIQLENGDILLIAETLISKAEGNIIKMDD
VEVSDKAIEIAEKCKKDPKIVETILQESNEIVAVGPNFIVTETKHGFVCANSGIDESNVE
DGLATPMPENPDKSAKEIREYLEEKYQKEIAIIITDTQGRAFRVGAIGTAIGCSGINPLW
VRIGDTDLYGRALETTEVATADELAAAASLLMGQADEGIPIVLIRGFDAFNILRDTETGI
KPLLRPKEFDVFRK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgactttagaattatttggattaaaaaaaattcctttggtaaaaaaaggagatgacatt
gcaaagattatagaagatgacttgaaagaggaagatatccaacttgaaaatggagacatc
ttgctcatagctgaaacattaatttcaaaggctgaaggaaacatcataaagatggatgat
gttgaagtaagcgacaaagccatagaaatagctgaaaagtgcaaaaaagaccctaagatt
gtcgaaaccatccttcaggaatccaatgaaatcgttgcagtaggccctaatttcatagtt
acagaaaccaagcacggatttgtatgcgccaactctggaatagacgaatccaatgtagag
gacggattggctaccccaatgcctgaaaaccctgacaagtctgctaaggaaatcagagaa
tacttagaagaaaaatatcaaaaggagatagcaatcataatcacagacacccaaggaagg
gcatttagagtgggagcaatcggaactgcaatcggatgctctggaatcaaccccctttgg
gtgagaataggagatacagatctttatggaagggctcttgaaaccacagaagtggctaca
gctgatgagcttgcagctgctgcatccttattaatgggacaagcagatgaaggaattcct
atagttcttataagaggattcgatgcatttaatatccttagagatactgaaactggaatc
aagccactccttagaccaaaagagtttgatgtgtttagaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system