KEGG   Methanobrevibacter ruminantium: mru_1847Help
Entry
mru_1847          CDS       T01166                                 

Gene name
adh2
Definition
NADP-dependent alcohol dehydrogenase Adh2
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    mru_1847 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mru_1847 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    mru_1847 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    mru_1847 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    mru_1847 (adh2)
   00626 Naphthalene degradation
    mru_1847 (adh2)
Enzymes [BR:mru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     mru_1847 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2378355..2379335)
Genome map
AA seq 326 aa AA seqDB search
MAGTMKAWRINELGKPPVLEDVPIPEPGFGEILIKMKGAGMCRTDLEVIDEGFITVPFVG
PFTFGHENAGTVAKLGPGVDTVEVGQNVIVDTLHACGKCQYCLSGRDNFCEVASARGLKE
DGGMAEYMIADAREVAPLGDLDPTEYVALADAGLSPYGAVQTAKPFIPNNGTAVVIGVGG
LGFYCCQYLALTTSARVIVVNRSADKMAKMTNFGADELVVLDDNAYDKIMELTDGKGVDA
VFDFVGRDNTLELAAQITKGLGLISILGLGGGTLPVSWTTVKPGVMVRLTQGGTITDLYE
IMDLAKAGKITVQAQKYPFSKVFRSS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctggaactatgaaagcttggagaataaatgaattaggaaaacctcctgtattagag
gatgtccctataccagaacctggatttggtgaaatcttaattaaaatgaaaggtgcagga
atgtgcagaactgaccttgaagttatagatgaaggtttcattacagttccatttgtcgga
ccattcacatttggtcacgaaaacgcaggaactgttgcaaaactcggtcctggagtagat
actgttgaggttggacaaaatgtcattgtagacacattgcatgcatgtggtaaatgtcaa
tactgtctttcaggccgtgacaacttctgtgaagttgcaagtgcacgtggtcttaaggaa
gacggaggtatggcagaatatatgattgctgatgcaagggaagtcgctcctttaggtgac
cttgaccctacagaatatgtggcattggctgatgcaggtctatctccatatggtgctgta
cagactgcaaaaccattcattccaaacaatggtactgctgttgttatcggtgtaggggga
cttggattctactgctgtcaatatttagctttaacaacctctgctcgtgttattgtagta
aaccgttcagctgataagatggctaagatgacaaacttcggtgctgacgaattggttgtt
ttagatgacaatgcatatgataagattatggaattgactgacggcaaaggtgtagatgct
gtatttgactttgtaggaagagacaacactttagagcttgctgcacaaatcaccaaagga
ttaggtctcatttccattttaggtcttggtggaggaacacttcctgtaagctggaccaca
gtcaaacctggtgttatggtaagattgactcaaggtggaacaattacagacctttatgag
attatggacttggcaaaagctggtaaaattacagttcaagctcaaaaatatccattcagt
aaggtttttagaagctcttga

DBGET integrated database retrieval system