KEGG   Methanobrevibacter ruminantium: mru_2159Help
Entry
mru_2159          CDS       T01166                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase beta subunit TrpB2
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    mru_2159 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    mru_2159 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    mru_2159 (trpB2)
Enzymes [BR:mru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     mru_2159 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2849630..2850931
Genome map
AA seq 433 aa AA seqDB search
MQYRIDLTNDEVPTKWYNINADLPVELPAPKNSEGKDQISTLPQIFVNECLNQEFSTERY
IKIPSEVRELYQRLGRPTPLCRARGLEEKLNTPAKIYYKREDTSPTGSHKLNSAIAQAYY
AKKEGIERITTETGAGQWGTALCLAASMMDIECTVYMVRVSYDQKPFRKTIMQLYDGNVH
ASPSENTEVGRKVLAETPDTPGSLGIAISEAVEDALKYDDVKYTLGSVLNHVILHQTTIG
QEIKLQLEKAEEEPDTMIACVGGGSNFGGSLFPFIKDKIQGNSDTEFIAVEPSACPTLTE
GEYRYDFGDNMGFTPLLKMFTLGHNFVAPSVHAGGLRYHGMNTQISLLKNEGYITPVTAH
QRDVFAAGKMFAMCEGVIPAPETNHAIKAAIDEAKKCKETGEEKTIVVNFSGHGLMDFKG
YASYMDGSMENSK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagaattgatttaactaacgatgaagtacctacaaaatggtacaatattaac
gctgatttacctgtagagcttcctgctcctaaaaacagtgaaggaaaagatcaaatatca
accttacctcaaatatttgtaaacgagtgtctaaaccaagagttctccacagaaagatat
ataaaaattccatctgaagtaagagagctctaccaaagattgggaaggccgactccttta
tgcagagcaagaggattggaagaaaagctcaacacaccagcaaagatctattataagaga
gaagacacctctccaactggaagtcacaagttaaacagtgcaattgcacaggcatattat
gcaaaaaaagaaggaatcgaaagaataacaaccgaaacaggagccggacaatggggtact
gcattatgtcttgcagcatcaatgatggacattgaatgtacagtatatatggtaagggtt
tcatacgaccaaaagccattcagaaagaccatcatgcaattatacgacggaaacgtacac
gcatcccctagtgaaaacactgaagtgggtagaaaagtccttgcagaaactccggacact
cctggttcccttggaatagcaatttctgaagctgtagaagacgctttaaaatatgatgat
gtaaaatacacccttggaagtgttttaaaccacgttatcctacaccaaaccacaattggt
caggaaatcaaattacagcttgaaaaagctgaagaagagccagacacaatgattgcatgt
gtaggtggaggaagtaacttcggtggatcattattcccattcattaaagacaaaatccaa
ggaaacagcgacactgaattcatagcagttgaaccttcagcttgcccaaccttaacagaa
ggtgaatacagatacgactttggagacaatatgggattcactccgcttttaaagatgttt
acattaggacacaacttcgttgctccttctgtacacgctggaggacttagataccatggt
atgaacactcaaatatccttgcttaaaaacgaaggttacattacccctgttacagctcat
caaagagatgtatttgcagcaggtaagatgtttgcaatgtgcgaaggagtcattccagca
cctgaaacaaaccacgcaattaaagcagctatcgatgaagctaaaaagtgcaaagaaact
ggcgaagagaaaactattgttgttaacttctcaggccatggtttaatggactttaaagga
tacgcaagttacatggacggatccatggaaaattccaaatag

DBGET integrated database retrieval system