KEGG   Methanobrevibacter ruminantium: mru_2213Help
Entry
mru_2213          CDS       T01166                                 

Gene name
fucA
Definition
fuculose 1-phosphate aldolase FucA (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mru  Methanobrevibacter ruminantium
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mru00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    mru_2213 (fucA)
Enzymes [BR:mru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     mru_2213 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2930137..2930724
Genome map
AA seq 195 aa AA seqDB search
MEKEIVKSVVEMSAYVFERGLVSGKAGNVSARFKTDHGDIVAITPTLKSLADLEDKDIIL
VDSEGNNLTKGKPSSELGMHLAIYREKPDVYGIVHTHSPYATGFAFSNKRIKRLEGFGQI
KSEYIKDIDYYKPGSEELAKNAAEALKEEDVIVLRNHGVIATGSTVKEAATLVEFVEESA
KTQFVTLVLNSLDEK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaaatagtaaaatcagttgtagagatgtcagcttatgtatttgaaagaggc
cttgtatcagggaaagctggcaatgtaagcgcaagattcaagacagaccatggtgacata
gtcgccataactccaacacttaaatcccttgctgatttggaagataaggacataattctt
gttgattcagagggcaataatctaactaaaggcaagccatcctctgaacttggaatgcat
ctggcaatctatcgtgaaaagccagatgtctatggaatcgtacacacccattcaccttat
gcaacaggattcgccttttccaataaaagaataaagcgtttggaaggattcggacaaata
aaatcagaatacattaaagatatagactactataagcctggaagtgaagaacttgctaaa
aatgctgctgaagcattgaaggaagaggatgttattgtcctaaggaatcatggagtcatc
gccactggatctactgttaaagaggctgccacacttgttgaattcgttgaagaaagtgct
aaaacccaatttgtgacactagtcttgaattccttagatgaaaaatag

DBGET integrated database retrieval system