KEGG   Mycobacterium smegmatis JS623: Mycsm_00187Help
Entry
Mycsm_00187       CDS       T02423                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:msa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:msa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196376..197548
Genome map
AA seq 390 aa AA seqDB search
MALPRRLCVLAALTTLMAACSSPAPQPAPSATTPAPTIAATVAPAPAADPAAPACGDGPA
LLASMTTRDKLAQLLMVGVTGAADARAVVENHHVGGIFIGSWTDLSMLSDGTIANIAETG
PLPLAVSVDEEGGRVARLSSLIGSQPSPRVLAASHTPEEVYNIALARGQAMRKLGITIDF
APVVDVTNAPDDTVIGDRSFGADPAAVTDYAGAYARGLRDAGLLPVLKHFPGHGHGSGDT
HTGSVVTPPLADLQAGDLIPYRTLTTQGPVGVMVGHIEVPGLTGSDPASLSPAAYALLRS
GDYGGPGFTGPVFTDDLSSMQAISDRMGVAEAALRGLQAGADIALWVTTDEVPAVLDRLE
KALAAGELTMPRVDASVLRMAAVKGRNPRC
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcctcgtcgactgtgtgtcctggcggcgctgaccacgctaatggcggcctgt
tcgtcgccggccccacaacctgcgccgtctgcgacgacaccggctccgacaattgctgcg
accgttgcgcctgcgccggcggccgaccctgccgcgccggcgtgcggcgacgggcctgcg
ctgctggcgagcatgaccacccgcgacaagctggcccagctgttgatggtcggggtcacc
ggcgcggccgacgctcgcgccgtcgtcgagaaccaccacgtcggtggcatcttcatcggt
agctggaccgacctgtcgatgctgtccgacggcacgatcgccaatatcgccgagacgggt
ccgctgccactggcggtcagtgtcgacgaggagggcggccgagtggcccggctttcatcg
ctgatcggcagccagccgtcaccccgcgtgctcgcggccagccacacgccagaagaggtc
tacaacatcgcgcttgcgcgaggccaggcgatgcgcaagctcggcatcaccatcgatttc
gcacccgtcgtcgacgtcaccaacgcgcccgacgacaccgtgatcggtgaccgctcgttc
ggcgccgacccggcggccgtcacggactacgcgggcgcctacgcccgcgggctgcgcgac
gccggcctcctgcctgtactcaagcacttccccggccacggccacggttcgggcgacaca
cacaccggaagtgtcgtcaccccgccgctggctgatctgcaggcaggtgatctgatcccg
tatcgcacgctcaccacccagggtccggtcggcgtgatggtgggccacatcgaggtgccc
gggctgaccggcagtgacccggccagcctgagccctgcggcctacgcgctgctgcgctcg
ggtgactacggcggtcctggcttcaccggccccgtgttcaccgacgacctgtccagcatg
caggccatcagcgaccggatgggcgtcgccgaggcggccttgcgcggattgcaggccggt
gcggacatcgcgttgtgggtgaccaccgacgaggtgcctgcggtgctggaccggctggaa
aaggcgctggccgcaggcgaattgacgatgccgagggtcgacgcatcggtgctgcggatg
gccgcggtcaagggccgcaatccgcgctgctga

DBGET integrated database retrieval system