KEGG   Mycobacterium smegmatis JS623: Mycsm_00187Help
Entry
Mycsm_00187       CDS       T02423                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_00187
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mycsm_00187
Enzymes [BR:msa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mycsm_00187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196376..197548
Genome map
AA seq 390 aa AA seqDB search
MALPRRLCVLAALTTLMAACSSPAPQPAPSATTPAPTIAATVAPAPAADPAAPACGDGPA
LLASMTTRDKLAQLLMVGVTGAADARAVVENHHVGGIFIGSWTDLSMLSDGTIANIAETG
PLPLAVSVDEEGGRVARLSSLIGSQPSPRVLAASHTPEEVYNIALARGQAMRKLGITIDF
APVVDVTNAPDDTVIGDRSFGADPAAVTDYAGAYARGLRDAGLLPVLKHFPGHGHGSGDT
HTGSVVTPPLADLQAGDLIPYRTLTTQGPVGVMVGHIEVPGLTGSDPASLSPAAYALLRS
GDYGGPGFTGPVFTDDLSSMQAISDRMGVAEAALRGLQAGADIALWVTTDEVPAVLDRLE
KALAAGELTMPRVDASVLRMAAVKGRNPRC
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcctcgtcgactgtgtgtcctggcggcgctgaccacgctaatggcggcctgt
tcgtcgccggccccacaacctgcgccgtctgcgacgacaccggctccgacaattgctgcg
accgttgcgcctgcgccggcggccgaccctgccgcgccggcgtgcggcgacgggcctgcg
ctgctggcgagcatgaccacccgcgacaagctggcccagctgttgatggtcggggtcacc
ggcgcggccgacgctcgcgccgtcgtcgagaaccaccacgtcggtggcatcttcatcggt
agctggaccgacctgtcgatgctgtccgacggcacgatcgccaatatcgccgagacgggt
ccgctgccactggcggtcagtgtcgacgaggagggcggccgagtggcccggctttcatcg
ctgatcggcagccagccgtcaccccgcgtgctcgcggccagccacacgccagaagaggtc
tacaacatcgcgcttgcgcgaggccaggcgatgcgcaagctcggcatcaccatcgatttc
gcacccgtcgtcgacgtcaccaacgcgcccgacgacaccgtgatcggtgaccgctcgttc
ggcgccgacccggcggccgtcacggactacgcgggcgcctacgcccgcgggctgcgcgac
gccggcctcctgcctgtactcaagcacttccccggccacggccacggttcgggcgacaca
cacaccggaagtgtcgtcaccccgccgctggctgatctgcaggcaggtgatctgatcccg
tatcgcacgctcaccacccagggtccggtcggcgtgatggtgggccacatcgaggtgccc
gggctgaccggcagtgacccggccagcctgagccctgcggcctacgcgctgctgcgctcg
ggtgactacggcggtcctggcttcaccggccccgtgttcaccgacgacctgtccagcatg
caggccatcagcgaccggatgggcgtcgccgaggcggccttgcgcggattgcaggccggt
gcggacatcgcgttgtgggtgaccaccgacgaggtgcctgcggtgctggaccggctggaa
aaggcgctggccgcaggcgaattgacgatgccgagggtcgacgcatcggtgctgcggatg
gccgcggtcaagggccgcaatccgcgctgctga

DBGET integrated database retrieval system