KEGG   Mycobacterium smegmatis JS623: Mycsm_00224Help
Entry
Mycsm_00224       CDS       T02423                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:msa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(245973..247121)
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRADELATLLERRGATVTCAAAIAMVPLPDDEQLRAHTEGL
IARPPDIVVATTGIGFRGWFAAADGWGLSDELLGALGNARIVSRGPKSTGALRAAGLPEE
WSPESESSREVLHYLVEGGIAGKRIAVQLHGATDDWDPFPEFIDELRSAGAEVVPIRVYR
WHPAPRNGDFDQLVAGIAEFKFDAVSFTSAPAVASVLMRAVELGIEDKVLSALRTDVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQSRTLRVAGHVLEIRGTCVMV
DGVVKALSPAGMATIRALAHQPGAVVSRFDLLGALPGSGTDTHAVETAVLRLRTALGDKN
IVSTVVKRGYRLAIDDEFAHSL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcccgactgggcaccgctcaccggttttcgggtggcggtgacctctgcccga
cgtgcggacgaactggcgaccctcctggaacgacgcggtgccaccgtcacgtgtgccgcg
gccatcgcgatggtgccgctacccgacgacgagcagctgcgtgcacacaccgaagggctg
atcgcccgaccgcccgacatcgtggtcgcgaccacggggatcgggtttcgcggctggttc
gccgccgctgacggctgggggctgtctgacgaactgctcggagcgctcggcaatgcgcgc
atcgtgtcgcggggaccgaagtcgaccggcgcgctgcgcgcggcaggcctgcccgaggaa
tggtcgcccgaatccgagtcgtcgcgcgaggtactgcactacctggtcgaaggcggcatc
gccggcaagcgcatcgcggtgcagttgcacggagccaccgatgactgggatccgttcccc
gagttcatcgacgaattacgttctgccggtgcggaagtggtgccgattcgggtgtaccgc
tggcatccggcaccccgcaacggcgatttcgatcaactggtggcgggtatcgccgaattc
aagttcgacgcggtcagcttcacgtcggcgcccgcggtcgcctcggtcctgatgcgcgca
gtcgagcttggtatcgaagacaaggtgttgtccgcgttgcgaactgacgtacacgcgatg
tgtgtcggacccgtgacagcaaggccattggtccggctcggggtgccgacgtcggcgccc
gaacgaatgcggttgggcgcgttggcccggcacatcaccgatgagctgccgctgctgcag
tcgcgcaccctgcgggtggcggggcatgtactggagatccgcggcacgtgcgtgatggtt
gacggcgtggtgaaggcgctgtcacccgccgggatggcgacgattcgcgccctggcccac
cagcccggcgcggtggtctcgcggttcgatctacttggcgcactgcctggcagcggtacc
gacacccacgcagttgagaccgcagtgctgcggctccgaacggcgttgggcgacaagaac
attgtgtcgacagtggtcaagcgcggttaccggttggcgatcgacgacgaatttgcgcac
tcgctatga

DBGET integrated database retrieval system