KEGG   Mycobacterium sp. JS623: Mycsm_00506Help
Entry
Mycsm_00506       CDS       T02423                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00071  Fatty acid degradation
msa00280  Valine, leucine and isoleucine degradation
msa00281  Geraniol degradation
msa00310  Lysine degradation
msa00360  Phenylalanine metabolism
msa00362  Benzoate degradation
msa00380  Tryptophan metabolism
msa00410  beta-Alanine metabolism
msa00627  Aminobenzoate degradation
msa00640  Propanoate metabolism
msa00650  Butanoate metabolism
msa00903  Limonene and pinene degradation
msa00930  Caprolactam degradation
msa01100  Metabolic pathways
msa01110  Biosynthesis of secondary metabolites
msa01120  Microbial metabolism in diverse environments
msa01130  Biosynthesis of antibiotics
msa01212  Fatty acid metabolism
Module
msa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycsm_00506
   00650 Butanoate metabolism
    Mycsm_00506
  Lipid metabolism
   00071 Fatty acid degradation
    Mycsm_00506
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycsm_00506
   00310 Lysine degradation
    Mycsm_00506
   00360 Phenylalanine metabolism
    Mycsm_00506
   00380 Tryptophan metabolism
    Mycsm_00506
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycsm_00506
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycsm_00506
   00281 Geraniol degradation
    Mycsm_00506
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycsm_00506
   00627 Aminobenzoate degradation
    Mycsm_00506
   00930 Caprolactam degradation
    Mycsm_00506
Enzymes [BR:msa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mycsm_00506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AGB20956
UniProt: L0IRX1
Position
complement(547126..548034)
Genome map
AA seq 302 aa AA seqDB search
MPTTSSQFETLLYKTDGPVATITLNRPDHLNTIVPPMPDEIEKAIGLAERDPAIKVIVLR
GAGRAFSGGYDFGGGFHHWADAMNTDGRWDPGKDFAMVSARETGPTQKFMAIWRASKPVI
AQVHGWCVGGASDYALCADIVIASDDAVIGTPYARMWGAYLTGMWLYRLSLAKVKWHSLT
GEPLTGKEAAAIELINESVPFENLEARVAEVAAKLANIPLSQLQAQKLIVNQAYENMGLA
STQTLGGILDGLMRNTPDALQFIDTASNQGVRAAIERRDGPWGDYSQAPPERRPDPNNVI
EP
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgacgtcatcccagttcgagacgctgctctacaaaaccgacggtcccgtcgcg
acgatcacgctgaacaggcctgaccacctgaacacgatcgtcccgccgatgcccgacgag
atcgagaaggccatcgggctggccgaacgcgaccccgcaatcaaggtcatcgtgttgcgc
ggggcaggccgtgcgttctccggtggctatgacttcggcggcggcttccaccactgggcc
gacgcaatgaacaccgacggccgctgggaccccggcaaggacttcgcgatggtcagcgcc
cgcgagaccggcccgacgcaaaagttcatggcgatctggcgggcctcgaaacctgtcatc
gcccaggtgcatggctggtgcgtcggaggcgccagcgattacgcgctgtgtgccgacatc
gtcatcgccagcgatgacgctgtgatcggcacgccctatgcccgcatgtggggcgcctac
ctgaccggcatgtggctgtatcggctgtcgctggcaaaggtgaaatggcattcgctcacc
ggtgagccgctgaccggaaaggaagctgccgcaatagaactcatcaatgagtctgtgccc
ttcgaaaacctcgaagcccgggtagccgaagtcgctgccaaactcgcgaacatcccgctg
tcgcaactgcaggcccaaaagctcatcgtcaaccaggcctacgaaaacatggggctggcc
tccacccagacgctcggcggcatcctcgacgggttgatgcgcaacacccccgacgcgctg
cagttcatcgacaccgcgtcgaatcagggtgtgcgcgccgcgatcgaacgccgtgacgga
ccgtggggtgactacagccaggcgccgccggagcgcaggcccgacccgaataacgtcatc
gagccctga

DBGET integrated database retrieval system