KEGG   Mycobacterium smegmatis JS623: Mycsm_00623Help
Entry
Mycsm_00623       CDS       T02423                                 

Definition
putative O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycsm_00623
Enzymes [BR:msa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     Mycsm_00623
Exosome [BR:msa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Mycsm_00623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651938..652699)
Genome map
AA seq 253 aa AA seqDB search
MSLTRTLRQKFPFLRYSLLRMAFGGLSVMRTGQMGDGREETMAGYVIANAPAGDVDAAID
AIDNFAYDKSILMNVGDEKGQLLDAAVKRANPKLAMELGAYCGYSGLRIARAAPGAMVFS
IEKSSANASVARRVWAHAGLADRVTCINGTVDDGTTLDVLAKDYGFTDGCLDFVFLDHWK
DVYLDDLRRLLDRGWLHPGTIVVADNVGFPGAPKYRTYMKEQQGKRWQTIEHQTHVEYQT
LLKDLVLESEFLG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgactaggacgctgcgacagaagtttccattcttgaggtactcgctcctgcgc
atggctttcggtggcctgagcgttatgcggacgggtcagatgggtgacggccgggaggag
acgatggccggttacgtcatcgccaatgctccggcgggcgacgtcgacgccgcgatcgac
gccatcgacaactttgcctacgacaagtcgatcctcatgaacgtcggcgacgagaagggc
cagctgctcgacgccgccgtcaagcgcgcgaatccgaagctcgccatggaactgggtgcc
tactgcggatacagcggtctgcggatcgcccgagcggcaccgggtgccatggtgttctct
atcgaaaagtcgagtgccaacgcctcggtggcccgccgcgtgtgggcgcacgccggcctc
gccgatcgcgtcacctgcatcaacggcaccgtcgacgacgggacgacgctcgatgtactc
gccaaagactacggattcactgacggctgtttggatttcgtcttcctcgaccactggaag
gacgtgtacctggacgacctgcggcggctactcgaccggggctggctgcatccgggaacg
atcgtggtcgccgacaacgtcggctttcccggcgcacccaagtaccgcacctacatgaag
gagcagcaaggcaagcggtggcagaccatcgagcaccaaacccacgtcgaatatcagacg
ctactcaaagacttagttctggagtcggagttcctgggctga

DBGET integrated database retrieval system