KEGG   Mycobacterium smegmatis JS623: Mycsm_00812Help
Entry
Mycsm_00812       CDS       T02423                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycsm_00812
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Mycsm_00812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(824886..825920)
Genome map
AA seq 344 aa AA seqDB search
MSTMRAVQVTGYHQNLQLAEVPIPTPTGPFDVVVKIGGAGVCRTDLHILEGQWAEKSQVP
LPYTIGHENAGWVHAIGTAVTNVREGDKVIVHPLITCGLCRACRSGDDVHCEASSFPGID
TDGGYAEYLKTSARSVVKIDEALEPADVAALADAGLTAYHAAAKAARRLTPRDRCVIIGA
GGLGHIGIQVLKALSPAELIVVDRNPEAVKLAMSIGAHHGVVADGTQVEQVLELTGGNGA
EAVIDFVGEGGSTSEGVRMLHRAGDYHVVGYGENINVPTIDIISTEINFIGNLVGSYNDL
CDLMALAARGAVTLHTAKYRLDDFQSAIDDLDAGNVRGRAILIP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccatgcgagccgtgcaagtaaccggctaccaccagaacctgcagctggcggag
gtaccgatcccgacaccgacagggccgttcgatgtggtggtcaagatcggcggtgccggt
gtatgccgaaccgatcttcacatcctcgagggccagtgggccgagaagtctcaggtgccg
ttgccgtacacgatcgggcacgagaatgccggttgggttcatgcaatcgggaccgcggtg
accaacgtccgcgagggagacaaggtcatcgtccacccgctgatcacctgcgggctgtgc
cgggcctgccgctccggcgacgacgtgcattgcgaggccagttcgtttcccggcatcgac
accgacggcgggtatgccgagtacctgaagacatcggcccgcagcgtggtgaagatcgat
gaagccctggaaccagcggatgtcgccgcgctcgccgatgccggtctgaccgcctaccac
gcagcagccaaggccgcgcggcgtctcacgccccgcgaccgctgcgtcatcattggggcc
ggtggacttggtcacatcggcattcaggtattgaaggcgctgagtcccgccgagctcatc
gtcgtcgaccgcaacccggaggccgtcaagctcgcgatgtccatcggtgcccaccatgga
gtcgtcgccgacggcacccaggttgaacaagttctcgagctcaccggtggtaacggtgcg
gaggctgtcatcgacttcgtcggcgagggcggctccaccagcgaaggggtgcggatgctt
cacagggccggcgactaccacgtcgtgggctacggcgaaaacatcaacgtcccaacgatc
gacatcatctccaccgagatcaacttcatcggcaatcttgtcggctcctacaacgacctg
tgcgatctgatggcgctggccgcccgcggcgccgtcacgctgcacaccgcgaaataccga
ctcgacgatttccaatcagccatcgacgacctcgacgccggcaacgtacgcggccgcgcc
atcctgatcccgtag

DBGET integrated database retrieval system