KEGG   Mycobacterium sp. JS623: Mycsm_00831Help
Entry
Mycsm_00831       CDS       T02423                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
msa  Mycobacterium sp. JS623
Brite
Enzymes [BR:msa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mycsm_00831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
844918..846084
Genome map
AA seq 388 aa AA seqDB search
MTMRRRTAFATALVLVLMIGAGWRIANAIDPRLDTGEIAALREHTARIAGQQFLDEYVES
DGRVVRRDEGGDVVSEGQAYGMLIAAAVGDETRFRSIWKWTKTHLRRADGLLSWRWADDK
ITGANSAADADLDAARALVLAGRRFNAPELTNDGKRLGEAILDTESVAVGTGVAAPSDVN
PPGTWVAGSGRILVGGNWANAAPYVVNPGYFSPRAERDLLEISADRRWTDITRTQRVLGW
QLIGTGMLPPDWATVSEVGHAVPTGPVTGGPVRFGLDASRLPVRFAESCDPDDRALAGAM
RPLLTAPGEVPALRNLNGSAAGSWQHPVGLVAAAATEQGVGNPDGAVERLDAAAQLEQRS
PTYYGAAWVALGRIMLTTSLLGECPSAS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgacggaggaccgcgttcgcaactgcgctcgtattggtgttgatgatcggc
gccggctggcggatcgcgaacgcgatcgatccgcggctggatacgggcgagatcgccgcc
ttgcgggagcacacggcgcgtatcgccggccaacagttcctggatgagtacgtcgaatcc
gacggccgggtggtgcggcgtgacgagggcggtgacgtcgtgagcgaggggcaggcctac
gggatgctcatcgccgcggcagtcggtgacgagactcggttccggtcgatatggaagtgg
acgaaaactcacttacgccgcgctgacggtctgctctcctggcggtgggccgatgacaag
atcaccggcgccaacagcgccgcggatgccgatctcgatgcggcgcgggcgttggtgttg
gcgggccgccgcttcaatgcgccggaactcaccaacgacggcaaacggttgggcgaggcg
atcctcgacaccgagtctgtcgccgtcggcaccggggtcgccgctccgagcgatgtgaat
ccgccaggtacgtgggtggccgggtcggggcgcattctcgtcggcggaaattgggccaac
gccgcgccgtacgtcgtcaatccggggtacttcagccctcgcgccgaacgggacctcctg
gagatatcggctgaccggcggtggacggacatcacccgcacccagcgggtcctggggtgg
cagctgatcggaaccgggatgctgccgcccgattgggccaccgtcagtgaagtgggccac
gccgtgcccaccgggcccgtcaccggaggacccgtacgcttcggtctcgacgcctcgcgc
ctacccgttcggttcgcagaatcctgcgatccagacgaccgggccctcgcgggtgcgatg
cgacccttgctgacggcgccgggtgaagttccggcgttgcgcaacctgaatgggtcggcc
gccggcagttggcagcatccggttggcctggtcgccgcagcggccaccgaacagggggtc
ggcaatcccgacggcgccgtcgagcgccttgacgcggcagcgcaactcgagcagcggtct
ccgacctattacggcgccgcgtgggtggcgctgggccgcatcatgctgaccacgtcgctg
ctcggcgaatgcccttccgccagttga

DBGET integrated database retrieval system