KEGG   Mycobacterium smegmatis JS623: Mycsm_00831Help
Entry
Mycsm_00831       CDS       T02423                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msa  Mycobacterium smegmatis JS623
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycsm_00831
Enzymes [BR:msa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mycsm_00831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
844918..846084
Genome map
AA seq 388 aa AA seqDB search
MTMRRRTAFATALVLVLMIGAGWRIANAIDPRLDTGEIAALREHTARIAGQQFLDEYVES
DGRVVRRDEGGDVVSEGQAYGMLIAAAVGDETRFRSIWKWTKTHLRRADGLLSWRWADDK
ITGANSAADADLDAARALVLAGRRFNAPELTNDGKRLGEAILDTESVAVGTGVAAPSDVN
PPGTWVAGSGRILVGGNWANAAPYVVNPGYFSPRAERDLLEISADRRWTDITRTQRVLGW
QLIGTGMLPPDWATVSEVGHAVPTGPVTGGPVRFGLDASRLPVRFAESCDPDDRALAGAM
RPLLTAPGEVPALRNLNGSAAGSWQHPVGLVAAAATEQGVGNPDGAVERLDAAAQLEQRS
PTYYGAAWVALGRIMLTTSLLGECPSAS
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcgacggaggaccgcgttcgcaactgcgctcgtattggtgttgatgatcggc
gccggctggcggatcgcgaacgcgatcgatccgcggctggatacgggcgagatcgccgcc
ttgcgggagcacacggcgcgtatcgccggccaacagttcctggatgagtacgtcgaatcc
gacggccgggtggtgcggcgtgacgagggcggtgacgtcgtgagcgaggggcaggcctac
gggatgctcatcgccgcggcagtcggtgacgagactcggttccggtcgatatggaagtgg
acgaaaactcacttacgccgcgctgacggtctgctctcctggcggtgggccgatgacaag
atcaccggcgccaacagcgccgcggatgccgatctcgatgcggcgcgggcgttggtgttg
gcgggccgccgcttcaatgcgccggaactcaccaacgacggcaaacggttgggcgaggcg
atcctcgacaccgagtctgtcgccgtcggcaccggggtcgccgctccgagcgatgtgaat
ccgccaggtacgtgggtggccgggtcggggcgcattctcgtcggcggaaattgggccaac
gccgcgccgtacgtcgtcaatccggggtacttcagccctcgcgccgaacgggacctcctg
gagatatcggctgaccggcggtggacggacatcacccgcacccagcgggtcctggggtgg
cagctgatcggaaccgggatgctgccgcccgattgggccaccgtcagtgaagtgggccac
gccgtgcccaccgggcccgtcaccggaggacccgtacgcttcggtctcgacgcctcgcgc
ctacccgttcggttcgcagaatcctgcgatccagacgaccgggccctcgcgggtgcgatg
cgacccttgctgacggcgccgggtgaagttccggcgttgcgcaacctgaatgggtcggcc
gccggcagttggcagcatccggttggcctggtcgccgcagcggccaccgaacagggggtc
ggcaatcccgacggcgccgtcgagcgccttgacgcggcagcgcaactcgagcagcggtct
ccgacctattacggcgccgcgtgggtggcgctgggccgcatcatgctgaccacgtcgctg
ctcggcgaatgcccttccgccagttga

DBGET integrated database retrieval system